KEGG   Thermomonospora curvata: Tcur_4500Help
Entry
Tcur_4500         CDS       T01127                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tcu  Thermomonospora curvata
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tcur_4500
Enzymes [BR:tcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tcur_4500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5101280..5101855)
Genome map
AA seq 191 aa AA seqDB search
MTTPDLTATGGHLLVPQRAVLSLGSNLGDRLSNLQEAIDALFDAPGLTFVALSPVYETTP
YGGPEGEIPEQDDYLNVVLVADTSLAPRVLLERVLNIENSMQRVREVRWGPRTLDIDIVM
FGNVTCNEPDLILPHPRAHERAFVLVPWADIEPDVLLPGHGRVADLAAAALRATGPDAVR
RRDDLTLQEPA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccgacctgaccgccaccggcggccacctgctggtcccgcagcgcgcggtg
ctgtcgctgggcagcaacctcggcgaccgcctgagcaacctccaggaggccatcgacgcg
ctgttcgacgcccccggcctgacgttcgtggcgttgtcgccggtgtatgagaccaccccg
tacggcggtccggaaggcgaaatccccgaacaagacgactacctgaacgtggtgctggtg
gccgacaccagcctggccccgcgggtgctgctggagcgggtgctcaacatcgaaaactcc
atgcagcgggtccgcgaggtccgctgggggccgcgcaccctggacatcgacatcgtgatg
ttcggcaacgtgacctgcaatgaaccggatctgatcctgccgcatccgcgggcgcacgag
cgggcgttcgtgctggtgccgtgggcggacatcgaaccggacgtgctgctgcccggccac
ggccgggtggccgacctggcggcggcggcgctgcgcgcgaccggcccggacgcggtgcgg
cgccgcgacgacctgaccctgcaagagcccgcgtga

DBGET integrated database retrieval system