KEGG   Thermomonospora curvata: Tcur_4614Help
Entry
Tcur_4614         CDS       T01127                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00071  Fatty acid degradation
tcu00280  Valine, leucine and isoleucine degradation
tcu00281  Geraniol degradation
tcu00310  Lysine degradation
tcu00360  Phenylalanine metabolism
tcu00362  Benzoate degradation
tcu00380  Tryptophan metabolism
tcu00410  beta-Alanine metabolism
tcu00627  Aminobenzoate degradation
tcu00640  Propanoate metabolism
tcu00650  Butanoate metabolism
tcu00903  Limonene and pinene degradation
tcu00930  Caprolactam degradation
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tcur_4614
   00650 Butanoate metabolism
    Tcur_4614
  Lipid metabolism
   00071 Fatty acid degradation
    Tcur_4614
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tcur_4614
   00310 Lysine degradation
    Tcur_4614
   00360 Phenylalanine metabolism
    Tcur_4614
   00380 Tryptophan metabolism
    Tcur_4614
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tcur_4614
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tcur_4614
   00281 Geraniol degradation
    Tcur_4614
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tcur_4614
   00627 Aminobenzoate degradation
    Tcur_4614
   00930 Caprolactam degradation
    Tcur_4614
Enzymes [BR:tcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tcur_4614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: ACZ00136
UniProt: D1A637
Position
complement(5226083..5226934)
Genome map
AA seq 283 aa AA seqDB search
MTEEVVRYERRGKIAVVTMNRPQYRNAQNSAMTYALDRAFYRAVDDDEVAVIVLAGAGPH
FSAGHDIGTPGRDADQTFERKASLWWDHVGKAGGESRYARESEVYLGMCRRWREIPKPTI
AMVQGACIAGGLMLAWVCDLIVASDDAFFADPVVRMGIPGVEYFAHPWVMGPRQAKEFLF
TGERISAARALELGMINRVVPRDRLEEEVMALAEKIATMPRFGLALTKKAINQAEDLMGL
HAGMDSVFGLHHFAHAHNAEVGGDSLAGQDARSMAARNKKEGA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggaagtggtccgctacgagcggcgcggcaagatcgccgtggtcacgatgaac
cggccgcagtaccgcaacgcccagaactccgccatgacctacgcgctggaccgggcgttc
taccgggcggtggacgacgacgaggtggcggtgatcgtgctggccggggccgggccgcac
ttttcggccgggcacgacatcggcacccccggccgcgacgccgaccagaccttcgaacgc
aaggcctcgctgtggtgggaccacgtcggcaaggccggcggggagagccgctacgcccgc
gagtccgaggtctacctgggcatgtgccggcggtggcgggagatccccaaacccaccatc
gccatggtgcagggcgcctgcatcgccggcgggctgatgctggcatgggtgtgcgacctg
atcgtcgcctccgacgacgccttcttcgccgacccggtcgtccgcatgggcatccccggc
gtggagtacttcgcccacccctgggtgatgggcccccgccaggccaaggagttcctgttc
accggcgagcgcatcagcgccgcccgcgccctggaactcggcatgatcaaccgggtggtc
ccccgggaccggctggaagaagaggtcatggcgctggccgagaagatcgccaccatgccc
cgcttcgggctggccctcaccaagaaggccatcaaccaggccgaggacctgatgggcctg
cacgccggcatggactcggtgttcgggctgcaccacttcgcccacgcccacaacgccgag
gtcggcggcgactccctcgccgggcaggacgcccgttccatggcggcgcgcaacaagaag
gaaggggcctga

DBGET integrated database retrieval system