KEGG   Thermomonospora curvata: Tcur_4645Help
Entry
Tcur_4645         CDS       T01127                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcu  Thermomonospora curvata
Brite
Enzymes [BR:tcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tcur_4645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5257469..5258779
Genome map
AA seq 436 aa AA seqDB search
MTSLNGGEHVIRAANTTGDFERAARLRDELVDTLRSRGKIVSPAVEKAFRTVARETFVPP
GTPLEEVYAVDRAVVTKTDEHGRSLSSVSATYIQARMIEMADIHPGMAVLEIGSGGYNAA
LLAEIVGPDGYVVSIDIDSEIVERAGALLSRTGYGGRVSVVHADAEYPVPGFGPFDRTLV
TVGAWDIPPAWLDQLVADGVLVVPLRMNGITRTIAFRRDGDHLTSSDAEVAGFVPIQGQG
AHTERTFLLPDPNGARLWLQFDSGAPEEIRLLDGVLATESVSVWSGVTIGKGISFADLHL
WLAAFLPGFCRISADPGTDLAAKLGKTWFPLGGVVGGSFAYLAVRPAMDDTGVEFGATAH
GGRAAAIALVEQIQAWDRTGRHRSPSFGFWPAGSTVPKLPEPSAVLHKRHGAVSISWLPA
SQNTPIIRPRRVGGVN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgctcaacgggggagagcacgtgatccgggcagcgaataccaccggcgacttc
gagcgggcggcacggttgcgagacgagctggtcgatacgctgcgatcgcgcgggaagatc
gtctcgcctgcagtggagaaggcgttccgcacggttgcccgtgagacgttcgtacccccc
ggcactcctcttgaggaggtctacgccgtagaccgcgcggtggtgaccaagaccgacgag
cacggcaggagcttgtcctcggtcagcgccacttacatccaggcccgcatgatcgaaatg
gcggatatccatcccggaatggccgttctggagatcggctcaggcggctacaacgccgcg
ctgctggccgagatcgtcggtccggatgggtatgtggtcagcatcgacatcgacagcgag
atcgtcgagcgtgccggcgccctgctgagccgaaccgggtatggcggtcgggtcagcgtt
gtgcacgcggacgccgaataccccgtgcccggcttcggcccgttcgatcggacgttggtc
accgtcggggcgtgggacatccccccggcctggctggaccaactggtcgccgacggtgtg
ctggtggtgccgctgcgcatgaacggcatcacccgaaccatcgcgttccgccgcgacggc
gatcacctgaccagcagcgacgccgaagtggccggattcgtgcccattcaggggcagggc
gcgcataccgagcggacattcctgctgccagatccgaacggcgcgcggctatggctgcag
ttcgactccggcgcccctgaagaaatacgcctcctcgacggtgtgctggcaaccgaatcg
gtgtcggtgtggtccggtgtcaccatcgggaagggcatctcgttcgccgacctgcatctg
tggctcgcggcgttcctgcccggattctgccggatcagcgccgaccctggtaccgatctg
gcggcgaagctgggcaagacctggttcccgctcggcggcgtagtcgggggttccttcgcc
tatctcgcagtgcggccggcgatggacgacacgggcgtggagttcggcgccaccgcccac
ggtggccgggccgcggccatcgctcttgtcgagcagatccaggcctgggaccgcaccggc
cgtcaccgcagtccctcgttcggtttctggcctgccggcagcaccgttcccaagcttccc
gagccctcggcggtgctgcacaaaaggcatggcgccgtctcgatctcctggctcccggcg
agccagaacacaccgatcattcgccctcgacgtgtgggaggagtgaactga

DBGET integrated database retrieval system