KEGG   Thermomonospora curvata: Tcur_4841Help
Entry
Tcur_4841         CDS       T01127                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcur_4841
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcur_4841
   00620 Pyruvate metabolism
    Tcur_4841
   00640 Propanoate metabolism
    Tcur_4841
  Energy metabolism
   00680 Methane metabolism
    Tcur_4841
Enzymes [BR:tcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tcur_4841
Lipid biosynthesis proteins [BR:tcu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tcur_4841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5491555..5493516
Genome map
AA seq 653 aa AA seqDB search
MSQETLSNLLQENRRFAPPAELAASANVTAQAYQEAERDRLAFWERQAERLSWAKRWDQV
LDWSNPPFAKWFVGGQLNVAYNCVDRHVEAGLGDRVAYHWEGEPGDTRTLTYADLQREVA
KAANALLELGVRKGDRVAIYLPMIPELPITMLACARIGATHSVVFAGFSSDALRTRIDDA
QAKVVVTADGQNRRGKQSPLKATVDEAVQHTPSVERVVVVRRTGQDIAWHDRDIWWHDLV
DRQSDQHTAEPHDAEHPLFILYTSGTTGKPKGILHTTGGYLTQVAYTHWAVFDLKPETDV
YWCSADIGWVTGHSYIVYGPLANAATSVIYEGTPDTPHRGRWWEIIQKYKVTIFYTAPTA
IRTFMKWGEDIPARFDLSSLRVIGSVGEPINPEAYVWYRHHIGADRCPVVDTWWQTETGA
IMISPLPGVTEGKPGAAMRPLPGIVADVVDDEGKPVPNGGGGFLVVKEPWPSMLRTIWGD
DDRYVKTYWSRFDGLYFAGDGAKKDDDGDLWLLGRVDDVMLVSGHNISTTEVESALVSHP
KVAEAAVTGATDPVTGQAIVAFVIPRGEAGEEVDGEEFVAELRDHVAKTLGPIAKPRQIM
VVPELPKTRSGKIMRRLLRDVAENRSLGDVTTLTDSSVMDLIAAKLPTAKPED
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggagaccctttccaacctgctgcaggagaaccggcgcttcgccccgcccgcg
gagctggccgcgtccgccaacgtcaccgcgcaggcctaccaggaggccgagcgcgaccgg
ctggccttctgggagcgccaggccgagcggctgagctgggccaagcggtgggaccaggtg
ctcgactggagcaaccccccgttcgccaagtggttcgtcggcggccagttgaacgtcgcc
tacaactgcgtggaccggcacgtggaggccgggctgggcgaccgggtcgcctaccactgg
gagggcgagcccggcgacacccgcaccctcacctacgccgacctgcagcgcgaggtcgcc
aaggccgccaacgcgctgctggagctgggcgtgcgcaagggcgaccgggtggcgatctac
ctgccgatgatcccggagctgcccatcaccatgctggcgtgcgcccggatcggcgccacc
cactcggtggtgttcgccgggttcagctccgatgcgctgcgcacccgcatcgacgacgcc
caggccaaggtggtcgtcaccgccgacggccagaaccggcggggcaagcagtccccgctg
aaggccaccgtggacgaggcggtgcagcacaccccgtcggtggagcgcgtggtggtcgtc
cgccgcaccggccaggacatcgcctggcacgaccgggacatctggtggcacgacctggtg
gaccggcagagcgaccagcacaccgccgagccgcacgacgccgagcacccgctgttcatc
ctctacacgtccgggacgaccggtaagcccaagggcatcctgcacaccaccggcgggtac
ctcacccaggtcgcctacacccactgggcggtgttcgacctgaagccggagacggacgtg
tactggtgctcggccgacatcggctgggtgaccgggcactcctacatcgtctacgggccg
ctggccaacgccgcgaccagcgtgatctacgagggcacgcccgacaccccgcaccggggc
cgctggtgggagatcatccaaaagtacaaggtcacgatcttctacaccgcgcccacggcg
atccgcacgttcatgaagtggggcgaggacatccccgcccgcttcgacctgtcgtcgctg
cgggtcatcggcagcgtgggcgagccgatcaaccccgaggcgtacgtgtggtaccgccac
cacatcggcgccgaccgctgcccggtggtggacacctggtggcagaccgagaccggggcg
atcatgatcagcccgctgccgggcgtcaccgagggcaagccgggcgcggcgatgcgcccg
ctgccgggcatcgtcgccgacgtggtggacgatgagggcaagccggtgcccaacggcggc
ggcgggttcctggtggtcaaggagccgtggccgtcgatgctgcggaccatctggggcgat
gacgaccggtacgtgaagacctactggtcgcggttcgacggcctgtacttcgccggggac
ggcgccaagaaggacgacgacggcgacctttggctgctgggccgggtggacgatgtgatg
ctggtctccggccacaacatctccaccaccgaggtggagtcggccctggtctcgcacccg
aaggtggccgaggccgcggtgaccggcgccaccgacccggtgaccgggcaggccatcgtg
gcgttcgtgatcccgcgcggggaggccggcgaggaggtcgacggcgaggagttcgtggcc
gagctgcgcgaccacgtcgccaagaccctcggcccgatcgccaagccccgccagatcatg
gtggtgccggagctgcccaagacccgctccggcaagatcatgcggcggctgctgcgggat
gtggccgagaaccggtcgctgggcgacgtcaccacgctgaccgacagctcggtgatggac
ctcatcgccgccaagctccccacggccaagccggaggactga

DBGET integrated database retrieval system