KEGG   Thermomonospora curvata: Tcur_4871Help
Entry
Tcur_4871         CDS       T01127                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tcu  Thermomonospora curvata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tcur_4871
DNA repair and recombination proteins [BR:tcu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tcur_4871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5516994..5517593
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQNLIDELGRLPGIGPKSAQRIAFHLLAADPADVDRLAKALKEVKDKVRFCRVCG
NVAEEEECRICRDPRRDPAVICVVEESKDVVAIEKTREFRGRYHVLGGAISPIEGVGPDD
LRIRELMQRLADGTVTELILATDPNLEGEATATYLARLVKPLNLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaggggtcgttcagaacctgatcgacgagctgggcaggctgcccggcatcggc
cccaagagcgcgcagcggatcgcctttcacctgctggccgccgacccggccgatgtggac
cggctggccaaggccctcaaggaggtcaaggacaaggtccgcttctgccgggtgtgcggg
aacgtggccgaagaggaggagtgccgcatctgccgggacccccgccgtgaccccgcggtg
atctgcgtggtggaggagtccaaggacgtcgtcgccatcgagaagacccgcgagttccgc
ggccgctaccacgtgctcggcggggcgatcagccccatcgagggcgtcggccccgacgat
ctgcggatccgggagctgatgcagcggctggccgacggcacggtcaccgagctgatcttg
gccaccgatccgaacctggagggcgaggccaccgccacctacctggcccgcctggtcaag
ccgttgaacctcaaggtcacccgcctggccagcggcctgccggtgggcggcgacctggag
tacgccgacgaggtcaccttgggccgtgcgttcgaaggacggaggctcctcgatgtctga

DBGET integrated database retrieval system