KEGG   Thiomicrospira crunogena: Tcr_0113Help
Entry
Tcr_0113          CDS       T00296                                 

Definition
uroporphyrinogen III methylase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tcx  Thiomicrospira crunogena
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcr_0113
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tcr_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
143466..144260
Genome map
AA seq 264 aa AA seqDB search
MTKPDPVLTFLNTRPVEQAEALSQSVREKGHQVLACPTLKICPRSLPQQAGVTLSTFDKV
FFISQNAVKQFVDMWQSAYQTHPVFAEKTECFAIGQSTYNAMKALDWPVAKVHSNQYVTE
ALLQSEVLQNLTDQQCLIVKGKGGRPTLAEGLIAAGATVTEWAVYERVPADFCDAQWQVF
RSARHPVLLISSLDAWYGLEKMLKNSGYGSKNDQAWLFLQDVIVFSDRIKHALQQQEWQG
RLFVVPQQSNAGILTALEQISIER
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcctgatccggttctgacctttttaaatacccgtccggttgaacaggccgag
gccttgtcacaatcggttcgggaaaaagggcatcaggtgttggcctgcccaacattaaaa
atttgtccacgttcattgccgcaacaagctggcgtcacgttgtcgaccttcgataaggtg
ttttttatcagccaaaatgcggtaaagcaatttgtagacatgtggcaatcggcttatcag
acgcatccggtttttgcagaaaagacagagtgtttcgccattggtcaaagcacctacaat
gcgatgaaggcacttgattggcccgttgctaaagtgcactcgaatcaatacgtcaccgag
gctttgctgcaatccgaagtcttacaaaacttgaccgatcaacaatgtttgattgtgaaa
ggaaaaggtggtcgccccacattggcagaaggactgatagccgcgggggcgacagtaacg
gaatgggcggtctatgaaagagtgcctgcggatttttgtgacgcgcaatggcaagtcttt
cgatccgcgcgtcacccagtattgcttatcagcagcctggatgcgtggtacggtttggaa
aaaatgttaaaaaacagtgggtatggaagtaaaaatgaccaggcctggctctttttacaa
gatgtgattgtgtttagtgaccgcattaaacacgcgttacagcagcaggaatggcaaggg
cgtttatttgtggttccacagcaaagtaacgccggcatattaaccgctctagagcaaatc
tcaattgaacgctga

DBGET integrated database retrieval system