KEGG   Hydrogenovibrio crunogenus: Tcr_0154Help
Entry
Tcr_0154          CDS       T00296                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00860  Porphyrin and chlorophyll metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
Module
tcx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcr_0154
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tcr_0154
Exosome [BR:tcx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tcr_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABB40750
JGI: Tcr0154
UniProt: Q31JC3
Position
complement(186250..187251)
Genome map
AA seq 333 aa AA seqDB search
MIERQFPITRMRRMRKDPFSRRLMREHVLTTNDLIYPMFVIEGQNRREPVKSMPDIERLS
IDLLITEAQELFELGIPMIALFPVPDPETKSLDAAEAYNPDGLAQRAVRALKEAIPDMGI
MTDIALDPYTTHGQDGIIDENGYVLNDDTIDVLMQQAISHAEAGADVVAPSDMMDGRIIE
IREHLEEHGHIHTRIMAYSAKYASSYYGPFRDAVGSAGNLGAGNKHTYQMDPANSNEALH
EVAMDINEGADMVMIKPGLPYLDIVYRVKQEFQAPTFVYHVSGEYAMLKAAALNGWINEK
DVVLETLLSCKRAGADGILTYYAKVVAQWLAEK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgccagtttcccattacacgtatgcgccgcatgcgaaaagatcccttctct
cgtcggcttatgcgtgagcatgttttaacgacgaacgacttgatttacccgatgtttgtc
atagaaggacaaaaccgccgtgagccggttaaatccatgccggacattgaacgtttgagt
atagatctattgattactgaagctcaagaactttttgaacttggcatcccaatgattgcg
ctttttccagtgccagatccagaaaccaaatctctggatgcagcagaagcttacaacccg
gatggattagctcaaagagccgttcgcgcccttaaagaagccattccagacatgggcatt
atgacggacattgccctagacccttacacgacacatggtcaagacggtattattgatgaa
aatggttatgtcctgaatgacgacaccattgatgtactcatgcaacaagccatttcacac
gctgaagctggggcagatgttgtggcgccatcagacatgatggatggtcgaatcatagaa
attcgtgaacatttggaagagcacggtcatatccatacccgtattatggcttactcggcg
aagtacgcttcgtcgtattatgggccattccgagatgcagtcggttcggcgggcaattta
ggcgctggtaataaacacacctatcaaatggacccagcgaacagcaacgaagcattgcat
gaggtcgcgatggacattaacgaaggcgcagacatggtaatgatcaagcccggcctgcca
tatcttgatattgtttatcgtgtgaaacaagaattccaagcccccacatttgtctaccat
gttagcggtgaatatgccatgctcaaagcagcggctttaaatggttggatcaacgaaaaa
gacgtcgtcttggagaccttattaagctgtaaacgtgcaggggcagacggcatcctgacc
tattacgccaaggtcgtcgcacaatggttagcggaaaaataa

DBGET integrated database retrieval system