KEGG   Thiomicrospira crunogena: Tcr_0200Help
Entry
Tcr_0200          CDS       T00296                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tcx  Thiomicrospira crunogena
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(237060..238118)
Genome map
AA seq 352 aa AA seqDB search
MLIDIKDVPEKAQRIFVQLIDIFEEQDINPTPLNYYIWYQYYKGDHPKFRQEMDNALQDP
FGYNDRLGRRLYDEYFSDEKSNNDFDRAFKRLINLVIKKMNVWSDKLEKHTQDLNQYTTS
LASEDIDAAKLKELTHSVLNTASSMKQSSEEFQKEMLSSNEEILRLRKELIEARAETLTD
ELTEVGNRKAFNNAIQDLADSTQDNPQSLVLILTDIDHFKRFNDTFGHLVGDSVLRYFAN
LMKKTRDDTETVCRYGGEEFAILLSHSSLEKAKERAESIRHSLETAKLKRKDSEKTLGKI
TASFGVAVYKGEDHETIDDWIKRADDALYEAKNQGRNRIITDEELEATSTSN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttgatagatattaaagatgtccccgaaaaagcccagcgcattttcgttcagctcatt
gatattttcgaagagcaagacattaatccgaccccgctgaattattatatttggtaccaa
tactacaaaggggatcaccctaaatttcgtcaagagatggacaatgcgctgcaagacccc
tttggctacaacgaccgcttagggcgacgcttgtacgatgaatacttttcggatgaaaaa
tcaaacaatgactttgatcgtgcatttaaacgtctgatcaatcttgtcattaaaaaaatg
aacgtgtggagcgataagcttgaaaaacacacccaagatttaaatcagtacaccacatct
ctcgcctcagaagatattgatgccgccaagctgaaagaattgacccattcagtattgaat
actgcttcatccatgaaacagtccagcgaagaatttcaaaaagaaatgctgagcagtaat
gaagaaatccttcgactacgaaaagaattgattgaagcacgagccgaaaccctaaccgat
gaattgaccgaagttggaaatcgcaaagcattcaacaatgccattcaagacttagcggac
agtacgcaagacaacccgcaaagtttggttttgattttaaccgacattgatcatttcaaa
cgctttaacgatacgtttggccatttggttggcgacagtgttctcaggtatttcgccaac
ttgatgaaaaaaaccagagacgacaccgaaaccgtttgccgttatgggggcgaagagttt
gcgattctgttatcccatagcagccttgaaaaagcgaaagagcgagccgaatccattcga
cacagcttggaaacggccaaacttaaacgtaaagattcggaaaaaacattaggaaaaatc
accgcttcatttggggtagccgtttacaaaggtgaagaccatgaaacgattgacgactgg
attaaacgtgcggatgatgcactttatgaagcgaaaaaccaaggtcgaaaccgaatcatt
acggatgaagagttggaagccacttcgacgtcaaattag

DBGET integrated database retrieval system