KEGG   Thiomicrospira crunogena: Tcr_0211Help
Entry
Tcr_0211          CDS       T00296                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tcr_0211
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_0211
  Lipid metabolism
   00071 Fatty acid degradation
    Tcr_0211
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tcr_0211
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tcr_0211
   00626 Naphthalene degradation
    Tcr_0211
Enzymes [BR:tcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tcr_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(250246..251433)
Genome map
AA seq 395 aa AA seqDB search
MIADFQIANLPKIQFGWGIRDQFAQAIAEQGFQSIVLISGQFLARPGGFSAALITQLQQA
NIRVNVFVVSGEPSPNLVDEIVKASPNNADAVIGIGGGSVLDAAKAVAGLIPSQTSVMDY
LEGVGKGLKLAGNTLPFIAMPTTAGTGSETTKNAVLSRLGEFKKSFRDDKLLAKEVWLDP
SFLPTCPHEVLYSTGMDAFTQLLESYTTLKANPITDALAWQGMTLFNGAFKAINSDNFEQ
QKTGYGNLMLAASLSGITLANAGLGAVHGLAGPIGAFFEAPHGVLCAALLAPITEANIQA
LKQSDEPHAESTLTKYAQIGTLLSGASNHTTDSLTALIEHLQQLTTTYLPNRLSEYGLHE
DNLAPVLTNCRSGSMTGNPLILSDEVLMSAIRQTL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagactttcaaatcgccaacctccctaaaattcaattcggctgggggattcga
gatcaatttgcacaagccatagcagaacaaggctttcaatctatcgtgctcatttcaggt
caatttttggccaggcctggcggtttttcagcggcgttgatcacccaactgcaacaagcc
aatattcgcgtcaatgtctttgttgtgtccggcgaaccctctccgaatctggtggatgaa
atcgtcaaagccagtccaaacaacgccgatgctgtgatcggcattggtggtggaagcgta
ttggatgccgccaaagcggtggccggtttgattcccagccaaacgtccgtgatggattat
ctcgaaggcgttggcaaagggcttaaattggcgggcaataccctgccttttatcgcgatg
ccaaccaccgccggcaccggcagcgaaaccaccaaaaacgcggttttgtcccgtttaggc
gaattcaaaaaatcctttcgcgatgacaagcttctcgcaaaagaagtgtggttagatccc
agctttcttccgacctgcccgcatgaagtgctttacagcacgggcatggatgcctttacc
caattattggaatcgtacacaacgctcaaagccaacccgattaccgatgcactggcatgg
caaggcatgactttatttaacggtgccttcaaagccatcaacagtgataattttgaacag
caaaaaaccggctatggcaacttaatgctggcggccagtttatccggcatcactctcgcc
aatgctggattgggcgctgtccatgggttagctgggccaatcggagccttttttgaagcg
ccccatggcgtgctgtgtgcggcgttactcgcaccgattaccgaagcaaacattcaagcc
ctaaaacagtcagatgagccccatgcagaaagcaccttaaccaaatacgctcaaataggt
accttattgtcaggcgcgtcaaaccatacgacagactctctcaccgcattaatcgaacac
ttacaacagctgacaaccacgtaccttcctaaccgactatcggaatatggattgcacgag
gataacctggcgccggttctaacaaactgtcgttcagggagcatgacaggaaaccctttg
attttatccgatgaggttctcatgtcagcaattcgacaaaccttataa

DBGET integrated database retrieval system