KEGG   Thiomicrospira crunogena: Tcr_0245Help
Entry
Tcr_0245          CDS       T00296                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:tcx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tcx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tcx00010]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:tcx00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
293974..294975
Genome map
AA seq 333 aa AA seqDB search
MTIKVGINGFGRIGRMAFRAAAKDFANIEVVAINDLLDPEYLAYMLKYDSVHGRFDGTVE
VKDGNLVVNGKTIRITAERNPADLAWSDVGADLVIECTGFFLTEESCQAHIEAGAKKVVQ
SAPSKDHTPMFVYGVNHEEYAGQAIVSAASCTTNGLAPVAKVLNDNFGIKRGLMTTVHAA
TATQKTVDGPSMKDWRGGRGILENIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTSDVS
VVDLTVELEKETSYDDICAAMKKASEGEMAGVLGYTEEANVSTDFRGDSHPSIFDAKAGI
ALDPTFVKVVAWYDNEYGYTCNMMRVVEHVGNN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactattaaagttggtattaacggttttggccgtatcggtcgtatggctttccgcgca
gctgcaaaagattttgcaaacattgaagttgttgcaattaacgatcttctagatcctgaa
tacctagcttacatgctgaagtatgattctgttcacggtcgtttcgacggaaccgttgaa
gtgaaagacgggaacttggttgttaacggtaaaacaatccgtatcactgcagagcgcaac
cctgctgacctagcttggtctgatgtcggtgctgacctagtcatcgaatgtactggtttc
ttcctaacagaagaatcttgtcaagcgcatatcgaagccggtgcgaagaaagttgttcaa
tcggcgccttctaaagatcacacgccaatgtttgtatatggtgttaaccatgaagaatat
gctggtcaagcaatcgtttctgcagcatcttgtacaacgaacggtttggcgccagtggct
aaagtattgaacgacaacttcggtatcaagcgtggtctgatgacgactgttcatgctgca
acagctactcagaaaacagttgacggtccttctatgaaagactggcgcggtggtcgtggt
attcttgagaatatcatcccttcttcaactggtgcggcaaaagcagtaggtaaagtatta
ccagcccttaacggtaagttaacgggtatggctttccgtgtaccaacgtctgatgtttca
gttgttgacctaacggttgagcttgaaaaagaaacgtcttatgacgacatttgtgcagcg
atgaagaaagcttctgaaggcgaaatggcgggcgttcttggttacactgaagaagctaac
gtttcaacagacttccgtggtgattctcacccatctatctttgacgctaaagcaggtatc
gcactggatcctacgttcgttaaagtggttgcatggtatgacaacgagtatggttataca
tgtaacatgatgcgtgttgttgagcatgtaggtaacaactaa

DBGET integrated database retrieval system