KEGG   Thiomicrospira crunogena: Tcr_0344Help
Entry
Tcr_0344          CDS       T00296                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tcx  Thiomicrospira crunogena
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcr_0344
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tcr_0344
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tcr_0344
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tcr_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
392281..393411
Genome map
AA seq 376 aa AA seqDB search
MLTRSDIHQKSRRWVVKIGSALLTNDGRGLNKDAMAQWVSQMVTLRQQGIELVIVSSGSV
AEGMQRLGWSQRPSELNELQAAAAVGQMGLVQAYESEFAKNGIHTAQILMTHDDLSNRAR
YLNASNTIQTLLEHGVVPVINENDTVVTDEIRFGDNDTLAALTANLVSADVLVILTDQNG
LYNDNPRTNPNAELISEAQVSRKDIEAMASSEGGSLGKGGMYTKVMAAKRAARSGTATFI
ASGREDNVLPRLLAGEPLGTLLIPDLEPLTAKKRWLAGHLQAKGQLVLDEGAVKALQSSG
KSLLPIGVKGMSGEFQRGEMVVCVNENNQEVARGLVNYPFFETQKIMGHPSSEINQLLGY
SDGEFLIHCDNLVLAD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacccgatcagatattcatcaaaaatcacgccgttgggtggttaaaattgggagt
gcattgttaaccaatgatggtcgtggtctgaataaagacgccatggcgcaatgggtgtct
cagatggtgacgttacgtcagcagggtatcgagcttgtgattgtgtcttccggctctgtg
gcggaaggcatgcagcgcttgggctggtcgcaacggccttctgaacttaatgaattgcaa
gcggccgcggcggttgggcagatggggctggtacaggcgtatgagtccgagttcgctaaa
aatggaattcacacagcacaaattttgatgacgcatgatgatttgtctaaccgtgcgcgt
tatttgaatgcctctaataccatccagacattgctagaacacggtgttgtgccggtcatt
aatgagaatgacacggttgtgaccgatgaaattcgttttggcgataatgataccttggca
gcattgactgcaaacttagtgtcggctgatgtgttggtgattctgaccgatcaaaatggc
ctctataatgacaatccacgcaccaatccaaatgcggagctgatttccgaagcacaggtc
agtcgaaaagatattgaagcaatggccagttcggaaggcggcagcttaggaaaaggcggc
atgtataccaaagtgatggcggctaagcgtgccgcacgctcagggacagcaacctttatt
gcttcaggccgggaagacaatgtgttgcctcgcttgttggcgggtgagccactggggacg
ttgttgattccagacctggagcctttgacggccaaaaagcgttggttggcgggtcatttg
caggccaaaggccagttggtgttggatgaaggtgcggtgaaagcgctgcagtcttcgggt
aaaagtctcctaccgattggcgtgaaaggcatgagtggtgagtttcagcgtggagagatg
gtggtttgcgtgaatgaaaacaatcaggaagtggcacgtgggttagtgaactatcctttt
tttgaaacgcaaaaaatcatgggacatccgtcttcggaaattaatcagctgttgggttac
agtgatggagaattcttgattcattgtgataacttagtcttggcagattag

DBGET integrated database retrieval system