KEGG   Hydrogenovibrio crunogenus: Tcr_0344Help
Entry
Tcr_0344          CDS       T00296                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00330  Arginine and proline metabolism
tcx00332  Carbapenem biosynthesis
tcx01100  Metabolic pathways
tcx01130  Biosynthesis of antibiotics
tcx01230  Biosynthesis of amino acids
Module
tcx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tcr_0344
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tcr_0344
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tcr_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SAM_2
Motif
Other DBs
NCBI-ProteinID: ABB40940
JGI: Tcr0344
UniProt: Q31IT3
Position
392281..393411
Genome map
AA seq 376 aa AA seqDB search
MLTRSDIHQKSRRWVVKIGSALLTNDGRGLNKDAMAQWVSQMVTLRQQGIELVIVSSGSV
AEGMQRLGWSQRPSELNELQAAAAVGQMGLVQAYESEFAKNGIHTAQILMTHDDLSNRAR
YLNASNTIQTLLEHGVVPVINENDTVVTDEIRFGDNDTLAALTANLVSADVLVILTDQNG
LYNDNPRTNPNAELISEAQVSRKDIEAMASSEGGSLGKGGMYTKVMAAKRAARSGTATFI
ASGREDNVLPRLLAGEPLGTLLIPDLEPLTAKKRWLAGHLQAKGQLVLDEGAVKALQSSG
KSLLPIGVKGMSGEFQRGEMVVCVNENNQEVARGLVNYPFFETQKIMGHPSSEINQLLGY
SDGEFLIHCDNLVLAD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacccgatcagatattcatcaaaaatcacgccgttgggtggttaaaattgggagt
gcattgttaaccaatgatggtcgtggtctgaataaagacgccatggcgcaatgggtgtct
cagatggtgacgttacgtcagcagggtatcgagcttgtgattgtgtcttccggctctgtg
gcggaaggcatgcagcgcttgggctggtcgcaacggccttctgaacttaatgaattgcaa
gcggccgcggcggttgggcagatggggctggtacaggcgtatgagtccgagttcgctaaa
aatggaattcacacagcacaaattttgatgacgcatgatgatttgtctaaccgtgcgcgt
tatttgaatgcctctaataccatccagacattgctagaacacggtgttgtgccggtcatt
aatgagaatgacacggttgtgaccgatgaaattcgttttggcgataatgataccttggca
gcattgactgcaaacttagtgtcggctgatgtgttggtgattctgaccgatcaaaatggc
ctctataatgacaatccacgcaccaatccaaatgcggagctgatttccgaagcacaggtc
agtcgaaaagatattgaagcaatggccagttcggaaggcggcagcttaggaaaaggcggc
atgtataccaaagtgatggcggctaagcgtgccgcacgctcagggacagcaacctttatt
gcttcaggccgggaagacaatgtgttgcctcgcttgttggcgggtgagccactggggacg
ttgttgattccagacctggagcctttgacggccaaaaagcgttggttggcgggtcatttg
caggccaaaggccagttggtgttggatgaaggtgcggtgaaagcgctgcagtcttcgggt
aaaagtctcctaccgattggcgtgaaaggcatgagtggtgagtttcagcgtggagagatg
gtggtttgcgtgaatgaaaacaatcaggaagtggcacgtgggttagtgaactatcctttt
tttgaaacgcaaaaaatcatgggacatccgtcttcggaaattaatcagctgttgggttac
agtgatggagaattcttgattcattgtgataacttagtcttggcagattag

DBGET integrated database retrieval system