KEGG   Thiomicrospira crunogena: Tcr_0489Help
Entry
Tcr_0489          CDS       T00296                                 

Definition
phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tcr_0489
   00565 Ether lipid metabolism
    Tcr_0489
   00590 Arachidonic acid metabolism
    Tcr_0489
   00591 Linoleic acid metabolism
    Tcr_0489
   00592 alpha-Linolenic acid metabolism
    Tcr_0489
Enzymes [BR:tcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Tcr_0489
    3.1.1.32  phospholipase A1
     Tcr_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
544997..546004
Genome map
AA seq 335 aa AA seqDB search
MNHFKEFVSRFAGIFLLYLCGAMFSTVAFSGPDYDSKCVQRALEEQAPDTTLEQVREQCL
SSFDQTQGKTALASRLEAEKRTKYSPFSILPYRPNYVLFGSYNFSETNEKPFREIALTGD
ESFEPYEVKFQISLKVPIADQLLGWGDHLFVGYTNRSFWQAYNSKISKPFRETNHEPEVW
MSFDNKWTIAGWRNRLIDLGLVHQSNGRSGTLSRSWDRAYLRMIFEKDNSAFAIKPWLRF
PESPGQDDNPDIMHYMGNAEFRFVTKQNRHQFSIMVRNNFDEQDNKGALELGYSFPIHRN
LNAYVQWFYGYGESLIDYDYKNNTVSIGVKLGNWL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcattttaaagagtttgttagccgtttcgcaggaatctttctactttatttatgt
ggggcgatgttttcgacggtggctttttctgggccggattatgactcaaagtgtgttcaa
agggctctggaagagcaggctccggacaccacgctggagcaagttagagagcagtgtctg
tcttcgtttgatcaaactcaaggtaaaaccgctctcgcttcaaggcttgaagctgaaaag
cgaactaaatacagtccattttccatcctgccttatcggcctaactatgttttgtttggc
tcgtataatttttctgaaaccaatgaaaagccttttagggaaattgctttaacgggcgat
gaatcttttgaaccctatgaggtcaaatttcagattagtttaaaagtgccgattgctgat
cagttactgggatggggggatcacttgtttgtagggtataccaaccgttcattttggcag
gcttataattccaaaatttcaaaacccttccgggaaaccaatcatgagcctgaagtctgg
atgagttttgataataagtggaccatcgcagggtggcgtaatcgactcatcgatttaggt
ctcgttcatcaatccaatggtcgttcaggaaccttgtcacgatcttgggatagagcgtat
cttcgaatgatttttgaaaaagataattcggcctttgcgataaagccttggttacgcttt
cctgaatcccccggtcaagatgataaccccgatatcatgcactacatggggaatgcggag
tttcgctttgtaaccaaacagaatcggcaccagttcagcataatggtgcgaaataatttt
gatgagcaagataataaaggggcgctggaattaggttatagtttccctattcatcggaac
ttgaacgcttatgttcaatggttttatggttacggcgaaagtttgattgattatgattat
aaaaataatacggtgagtataggtgtaaaactgggaaattggttgtag

DBGET integrated database retrieval system