KEGG   Thiomicrospira crunogena: Tcr_0507Help
Entry
Tcr_0507          CDS       T00296                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcr_0507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_0507
   00052 Galactose metabolism
    Tcr_0507
   00500 Starch and sucrose metabolism
    Tcr_0507
   00520 Amino sugar and nucleotide sugar metabolism
    Tcr_0507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tcr_0507
   00524 Butirosin and neomycin biosynthesis
    Tcr_0507
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tcr_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
567238..568200
Genome map
AA seq 320 aa AA seqDB search
MSFILAGDVGATKVLLQAYHQGEQRLLAEKRYLSADFFSLTLLVQHFQNEFDLPYFTAAC
FGVPGPVVGQQVRLTNLPWVIRADELAQTCQIDQVEILNDFYAAALGIDELTESDLICLQ
DGEYERLGNRLVIGAGSGLGVAPVKNCQGAFIPQPSEGGHMDFAPLNGHQIQILTWLQQK
WPHVSYERLLSGEGLETLYFFYNIQSHGHGKKSVTAAQIYQEAINGEKIACQTLDTFVQI
YGAFTGNAALIWEAKAGIFIAGGIAPKIKDWILKPLFMEAFLSKGRMRKVVETFPIYLVM
NEKVGLLGAMRRAQAINGDQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttattttagctggcgatgtcggtgccaccaaagtacttttacaagcctaccat
caaggtgagcaacggctcctggccgaaaaacgttatctgagcgccgattttttttcgctg
acacttcttgttcagcattttcaaaacgaatttgatcttccttattttacagccgcttgt
tttggtgtgcccggccctgttgtgggtcagcaagttcggttaacgaatcttccctgggtg
attcgagccgatgaattggcacaaacatgccagattgaccaggtggaaatccttaatgac
ttttatgcggcggcactcggcatcgatgaacttaccgaatctgatttgatttgtttgcaa
gacggggaatatgaacgcttaggaaatcgtcttgtgatcggcgctgggtcgggtttaggc
gtagcgccggtcaaaaactgtcagggcgcatttataccgcagccatctgaaggtggacac
atggattttgcgccgttgaatggacatcaaatccaaattttaacgtggttacaacaaaaa
tggccgcatgtttcttatgaacgactcttgtcaggcgaagggctagaaacgttgtatttt
ttctataatattcaatcacatgggcatggtaaaaaaagtgtgactgcggcccaaatttac
caagaagccatcaacggtgaaaaaattgcctgtcaaacactggatacttttgtacagatt
tatggcgcttttaccggcaatgccgctctaatttgggaggccaaagccggtattttcatt
gccggagggattgcccctaaaattaaggattggatattaaaaccgttatttatggaagcc
tttttaagcaaagggcgcatgcgtaaggtggttgaaacatttcctatttatttagtaatg
aatgaaaaagttggtctgcttggcgcaatgcggcgagctcaagcaatcaatggagatcaa
taa

DBGET integrated database retrieval system