KEGG   Thiomicrospira crunogena: Tcr_0510Help
Entry
Tcr_0510          CDS       T00296                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tcx  Thiomicrospira crunogena
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tcr_0510
Enzymes [BR:tcx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tcr_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
571373..572737
Genome map
AA seq 454 aa AA seqDB search
MSHKKAGVLLHPTSLPSGKLDEQAWRFLDWMAQANLSVWQMLPLTHPVQGLSPYQSVSAF
AMNPALLPANWLDMIDEADFQSYEEEPPHWLNDYALFMSLRQHFKMTSWIEWPEAYRYRD
FEALTLFAETHAYEIQILKKQQFVLRQIWQKLKDAAHEKGITLFGDMPIFVAYDSVDVWA
NSHLFKLDDNLNPTVVTGVPPDYFSETGQRWGNPHYDWQQMQKDGFQWWHHRIQSDLSLF
DLIRIDHFRGLEASWEIDVDEETAVNGHWVKVPGQLFLDSLQSAFPKLPLVAEDLGIITP
EVTALKERYDLPGMSVLQFGFNGLPDNPHALSEQVENSVVYTGTHDNDTSLGWWESLEDN
DYKQWVLSQLPSSEEAMPWPLIEAALQSVARLAMVPMQDFLSLGSDDRMNTPGTVENNWT
WQFRWDQVSPEITEKIAGLVNASGRDATQESTVL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaaaaaagcaggtgttttactccatcctacgtcattgccttcgggtaagttg
gatgagcaggcctggcggtttttagattggatggcacaagccaatctatccgtttggcaa
atgctaccgttaacccatcctgtgcagggattatcgccttatcaaagtgtttctgctttt
gcaatgaaccctgcgttactgccggccaattggttagacatgatcgatgaagccgacttt
caatcgtatgaagaagagcccccgcattggctaaatgactatgcgttgtttatgtcttta
cgacaacattttaagatgacctcgtggatagaatggccagaagcgtatcgttaccgtgat
tttgaggcattgactttatttgctgaaacacatgcgtatgaaatccaaattttaaaaaaa
cagcaatttgtgttacgtcaaatatggcagaaactgaaagatgctgcgcatgaaaaaggg
attaccttgtttggggatatgcctatttttgtcgcttatgacagtgttgacgtctgggca
aactcgcatttatttaaactggatgacaatctgaacccaacggttgtaacgggggttcct
cctgattatttttctgaaacaggacagcgatggggcaatcctcattatgattggcaacag
atgcaaaaagatgggtttcaatggtggcaccaccgcattcaatcggacttatcgctgttt
gatttgattcgaattgatcattttagagggttggaggcgagctgggaaattgacgttgat
gaagaaacggctgtgaatgggcattgggtgaaggtgccagggcaattgttcttagattct
ttacaaagtgcctttccaaaacttcctttggttgcggaagacttaggcattattacgcct
gaagtgacggcgttaaaagagcgctatgacttaccgggcatgtcagtgcttcaatttggt
tttaatgggttgccggacaacccgcatgcgttgtctgaacaagttgaaaactccgtggtg
tataccggaacacatgacaacgataccagcttggggtggtgggaatcgttagaagataat
gattataaacagtgggtcttatcgcaattaccttcttctgaagaagccatgccttggccg
ttaattgaggcggctttacagtcggttgcgcgcttggcaatggtgccgatgcaagatttt
ttgagcttgggaagcgacgatcgaatgaacacgcccggaaccgttgaaaataattggacg
tggcaatttaggtgggatcaagtgtcgccagaaataactgaaaaaatagccggcctggtg
aatgcttctgggcgagatgccacacaagagagtaccgttttatga

DBGET integrated database retrieval system