KEGG   Thiomicrospira crunogena: Tcr_0511Help
Entry
Tcr_0511          CDS       T00296                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tcx  Thiomicrospira crunogena
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tcx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
572734..574914
Genome map
AA seq 726 aa AA seqDB search
MMNQTVTEEAVRRLAEGTHHDPFQILGCHAVGKKWEVRVWLPTAESASVEGWHALTRVEG
TSLFIASLTEKQKKALPLHFKVNWVEANGSEHTVVSPYTFLPQLGELDLHLYAEGRHWHV
YDVLGAQVKEVDNISGVQFSVWAPAASRVSVVGDFNGWNGLRHPMRTNGQSGVWELFIPG
MVSGDIYKFEIRNYQTDQLLVKTDPYAKAMEFRPQTGSIVYDSTFQWQDRDWLAARAHFD
WQASPINIYEVHLGSWQRDHDGFFLNYKEIAQRLVEYVKWMGYTHIELLPISEHPLDESW
GYQTTGYFSPTSRFGSPDDFRYFVNYCHENGIGVFLDWVPAHFPKDEFALARFDGTALYE
HEDPRRGEHQDWGTYIFNYGRNEVRNFLIANALYWLKELHIDGLRVDAVASMLYLDYSRK
DGDWLPNQYGGRENIEAIEFLKTLNAEVHAQCPGALMMAEESTSWPMVSRPTWMGGLGFS
MKWNMGWMNDTLDFFQQDPIYRPYHHNQLTFSQMYAYSENFILPLSHDEVVHMKHALVSK
MPGDTWQKMANMRLLMGYQTLNPGKKLLFMGGEFAQWQEWSESRGLDWYLCEQPANRGVQ
MLVRDLNLLYQTSPALYCHDFDQEGFEWIDCHDYEQSVLSFVRISEKESLICVFNFTPVP
RYDYRIGLPETGIYEEVLNSDSELYGGGNVGNSGQLTTEDQRWMNRPCSTTLVLPPLAVV
VLRKKS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaaactgtgacagaagaagctgttcgaagacttgctgaaggaacacatcat
gatccttttcaaattttagggtgccatgccgttgggaaaaaatgggaggtacgtgtgtgg
ctccccacggctgaatcagcctctgtggaaggatggcatgctttgacgcgtgtggaaggc
accagtttattcattgcgagcttgacggaaaaacagaaaaaagcacttcccttgcacttt
aaagtgaactgggttgaagcgaatggctctgaacacacggtggtgtcgccctataccttt
ttaccccagttaggtgagttggatttacatctttatgccgaaggacgtcactggcatgta
tatgacgtgttaggcgctcaggtaaaagaagtagacaatatttcaggcgtgcagttttcg
gtttgggcgcctgcggccagtcgtgtttccgtcgtcggtgattttaatggttggaatggc
ctgcgccatcctatgcgtacgaatggacagtcaggcgtttgggagctttttattcccgga
atggtttcgggggatatttataagtttgaaattcgaaattatcaaaccgatcaactgctg
gttaaaacggacccttatgcaaaagccatggagttcaggcctcaaactggatcgattgtg
tatgactcgacgtttcaatggcaagaccgtgactggttagctgctcgcgcacattttgat
tggcaggcatcgccgattaatatttatgaagttcacttgggatcttggcaacgggatcat
gacggttttttcttgaattataaagaaattgcgcaacgtcttgtcgaatatgtgaagtgg
atgggatacacccatattgagcttctgccgatttcggaacacccgttagacgaatcttgg
gggtatcaaacaacagggtatttttctcctacgagccgttttggttcgccagacgatttt
cgatattttgtgaattactgtcatgaaaacggtattggcgtctttctggattgggttccg
gcgcactttccaaaagatgaatttgcactggctcggtttgacggtacagcgctgtatgaa
catgaagacccccgaagaggcgaacatcaggattggggcacttacatttttaattatggt
cgaaatgaagtgcggaactttctgattgccaatgcgctctattggttaaaagaattgcac
attgatgggctgcgtgtcgatgctgtggcgtccatgctttatctggattattcgcgtaaa
gatggtgattggttgccgaaccaatatggtgggcgagaaaatatagaagcgattgaattt
ttgaaaacgctcaatgctgaagtgcatgcccaatgccccggcgctttgatgatggcggaa
gaatcaacttcttggcctatggtctcacgtcctacatggatgggcggactcggtttttcg
atgaagtggaatatggggtggatgaatgacacgctggatttttttcagcaagaccccatt
tatcgaccgtatcaccataatcaactgacctttagccagatgtacgcttattcggaaaat
tttattttgcctttatctcacgatgaagtcgtgcatatgaagcatgcattggtcagtaaa
atgccaggagacacgtggcaaaaaatggcgaatatgcgtttgctcatggggtatcaaacg
ttaaaccccgggaaaaagctactctttatggggggtgagttcgcgcaatggcaagaatgg
agcgaaagccgcgggttggattggtatctttgtgaacaacccgccaaccgaggggtgcag
atgctggtgcgggatttgaatttgttgtatcaaacatcgcctgcattatattgtcatgat
tttgatcaagaaggatttgaatggattgattgtcatgattatgagcagtcggtactgagt
tttgtaagaatctccgaaaaagaatctttgatctgtgtctttaatttcacgcctgtgcct
cgttatgattatcgtataggcttgccggaaaccggtatttatgaagaggtgcttaattct
gattctgaactctatggcggtggtaatgtcggcaattcagggcaattaacgacagaggat
cagcgctggatgaatcgtccttgttcaaccacattagttttaccaccgcttgcagtggtt
gtgttaagaaaaaaatcctag

DBGET integrated database retrieval system