KEGG   Thiomicrospira crunogena: Tcr_0531Help
Entry
Tcr_0531          CDS       T00296                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tcx  Thiomicrospira crunogena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tcr_0531
DNA repair and recombination proteins [BR:tcx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tcr_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
594672..595265
Genome map
AA seq 197 aa AA seqDB search
MQSPVINELIDAFKLLPTIGPKSAQRLAYFLLQNHQQDGHRLASAIESALEKVGYCQQCR
NLSETEICGFCASKSRQTDQLCIVETPTDVVAIEQSGIYKGQYFVLMGHLSPIDGIGPDE
LGLPILRDRLAQGEIQELILATNPTVEGEATAHYIQQMAIEFNISVTRLAQGIPLGGELE
YIDSGTLGQAFAGRKAV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccctgttattaacgaactgatcgatgcttttaagttgttgccaaccattggg
ccgaaatcggcccaacgcttggcttatttcttattgcaaaatcatcagcaggatggtcat
cgcctagcgtctgcaatagaatctgcacttgaaaaagtggggtattgccagcagtgtcgc
aacttgtctgaaacggagatatgtggcttttgtgcctcaaaatcgagacaaaccgatcag
ttgtgtattgttgaaacgccaacggatgtggtggcgattgagcaatcaggcatctataaa
ggtcagtactttgtgttgatggggcatttgtcacctatagacggcattggtccagatgag
cttgggttgcctatcttacgagatagattggctcagggtgagatacaggagttgattcta
gcgacgaatcctacggtggaaggtgaggcgacggctcattatatccagcagatggcgata
gagtttaatatctctgtaacgcgtttggcgcaaggtattccgctgggtggcgagttagaa
tatatcgatagcggtacattaggtcaggcgtttgctggtcgtaaagcggtgtag

DBGET integrated database retrieval system