KEGG   Thiomicrospira crunogena: Tcr_0563Help
Entry
Tcr_0563          CDS       T00296                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tcx  Thiomicrospira crunogena
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tcx00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tcx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
633518..635035
Genome map
AA seq 505 aa AA seqDB search
MKQLADILSFFKLPESVLVNGATEVDVSALTIDSRQVERGTAFIALQGGQSHGMAHAEQA
IKQGASCILTDRAGLVEFNHSHQQPLNKTCPVIEVGSLNQQLATFAKWFYDAPSERVNVI
GVTGTNGKTSSSHYIAQMLTALNQKVALLGTLGNGWFGNLHPSINTTVDVVRLNHLLNGF
AEEQADYVVMEVSSHAIELGRIKGIDFDVLAMTQVTRDHLDFHKTEEAYQAAKKKLFLTY
SSRYQVINADDKVGQALFHELSNKDTIVRYSQQTAQADIVCLDSHLSRTGIHGTFTLQGG
SIPFDVPLMGQFNLENVLCAVSVMAACGFEWHRIQKALVFVKAVKGRMELLTQPGYPSVL
IDYAHTPDALEAILKAVQHHVSDRDATVWVVFGCGGDRDTGKRPLMGEIAETYANEVVLT
DDNPRTELPDAIVADIKKGMHRSVHVVHDRPEAIAFAIKKASSHDIVVIAGKGHEDYQEI
QGKRWPMSDQKIVKDLLSMAEVSMV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattggctgatatcctgagcttttttaagttacctgagtcggtactggtaaac
ggcgcgacggaagtggacgtttcggcattaacgattgattctcgccaagttgagagagga
accgcctttattgcattgcaaggtggacaatctcatggaatggctcatgctgaacaggcg
attaaacaaggtgcgagttgtattctgacggatagagcaggcctggtagaatttaatcac
tctcaccagcaaccactgaataagacgtgtcctgttattgaagtagggtcattgaatcaa
caattggcgacctttgctaaatggttctacgacgctcccagtgaacgcgttaacgtgatt
ggcgtaacgggcaccaatggaaaaacatctagcagtcactacattgcccagatgttgacc
gcgttaaatcaaaaagttgcgttgctgggaacactgggtaatggctggttcgggaatttg
caccccagcataaacaccactgttgatgttgtgaggctaaatcatttactgaatggcttt
gctgaagagcaagcggattatgtggtgatggaagtctcttctcacgctattgagctaggg
cgtattaaaggaatcgattttgatgtgctcgcgatgactcaggtgacacgagaccattta
gattttcataaaactgaagaagcttatcaagcggctaagaaaaaattatttttaacttac
tccagtcgatatcaagtcataaatgccgacgataaggtgggacaagcattatttcatgaa
ttgtcaaataaagacacaatagtacgttactcgcaacaaaccgctcaggccgatatcgtg
tgtttggatagtcacctgagccgcaccggaatacacggcacatttacattgcaaggcggc
tctattccgtttgatgtgcccttaatggggcagtttaatttagagaatgttttatgtgcc
gtttctgtgatggcggcttgtggctttgaatggcaccggatacaaaaagcattggtgttc
gttaaagcggtgaaagggcgtatggagctgttaactcagccaggatacccttcagtattg
attgattatgcgcatacgccagatgcactggaagccattttgaaagccgtgcaacatcat
gtttcagatagagatgcgacagtgtgggtggtgtttggttgcggaggggatcgcgatacc
gggaaacgtcctttaatgggtgagatagccgaaacgtatgcaaatgaagtggtgctgacc
gatgataaccctcgaaccgagttgccggatgcgattgtggccgatataaaaaaagggatg
catcgttccgtgcatgtcgttcacgaccgtccagaagcgattgcttttgcgattaagaaa
gcgtccagtcacgatatagtggtgattgccggtaagggacatgaagattaccaggaaatt
caaggaaaacgctggccaatgagtgaccaaaagattgtcaaagatcttttgagtatggct
gaggtaagcatggtttga

DBGET integrated database retrieval system