KEGG   Thiomicrospira crunogena: Tcr_0595Help
Entry
Tcr_0595          CDS       T00296                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tcx  Thiomicrospira crunogena
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tcx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
671663..673471
Genome map
AA seq 602 aa AA seqDB search
MCGICGEIYWDGQMASETKLVPMLAELEKRGPDDGGTWVQNHVGLGHRRLSIIDLSDGGH
QPMLDDEISLVFNGCIYNYETLSAELIELGHEFRSHSDTEVILKAYRQWGMECVSRFEGM
FAFAIWDDHQHQLLLARDRFGIKPLYYAPVEGGVRFASNTQALLASGGINTDIDPVGLHH
QFTLHAVVPAPHTILKGIRKLEPGHWMIVNPDGQMYKKSYWHLEAKRPTADNAPQTEKEW
IDAIHESLKQAVHKRLTAADVPVGVLLSGGLDSSLIVALLAEAGVEDIRTFSIGFEDVPE
EKGSEFEYSDLVVEQYQTAHQKYLIPNETVLPRLTEAVDAMAEPMFGQDAIAFYLLSEKV
SEDVKVVMSGQGADEVFAGYFWYPMMAKAAESLKDASRPVDAFAPYYFDRSHEEWLEMIE
DEFHVYDVTSELINDRLSDKGADSYLDQVLRLDTTTLIVDDPVKRVDNMTMAWGLEARVP
FLDHHLVELAMSAPTDLKLKDFKYILKKIARGIVPNEVIDRPKGYFPMPALKYVRGPFYE
MMKSILTSPQAKARGIFKPAYIQKLLDHPEADESFTAIKGSKLWHAALLELWLQRHVDPY
VQ
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttgcggagaaatttattgggatggccaaatggcctcggaaaccaaactg
gttccaatgttagccgaactggaaaaaagaggcccggatgatggcggtacttgggtgcaa
aatcatgtgggcttagggcatcgccgattgtccattattgatttgtctgacggagggcat
cagccgatgttggatgacgaaatcagcttggtgtttaatgggtgtatctataattatgaa
acgcttagcgccgaattgattgagttgggccatgagtttcgttcgcactccgataccgag
gtgattttaaaagcgtatcgtcaatggggaatggaatgtgtcagccgattcgaaggcatg
tttgcgtttgctatttgggatgatcaccagcatcagttgttgttggcgcgtgatcgattt
ggcattaaaccgctttactatgcacccgttgaaggtggagttcgttttgcatccaacacg
caagctttattggcttcgggtggcattaacacagatatagatcctgtcggactacaccac
caatttaccttacatgcggttgttcctgcgccgcatactattttaaaaggcattcgcaaa
cttgaacctgggcattggatgattgtgaaccctgatgggcaaatgtacaaaaaatcctat
tggcatttagaggccaaacgcccaacagcagataatgcgcctcaaaccgaaaaggaatgg
attgatgccattcatgaatcgttaaagcaagcggtgcataagcgattaacggcggccgat
gtaccggttggtgttttattatcgggcgggttggattcgagtttaattgtggctttgttg
gctgaggcaggggttgaggacattcgtacattttccattggctttgaagacgtaccggaa
gaaaagggcagtgaatttgaatattctgatttggtggtggagcaataccaaacggcgcat
caaaaatatttgattccgaatgaaacggtccttccacgattaaccgaagcggttgatgcg
atggccgaacccatgttcggacaggatgcaattgcattttatttgttatccgaaaaagtg
tctgaagacgtcaaggtcgtgatgtctgggcagggagctgatgaagtgtttgcaggttac
ttctggtatccaatgatggcaaaagcggcagaatctctaaaagacgcttcccgaccggta
gacgcttttgcaccctattactttgatcgatctcatgaagaatggttggagatgattgaa
gatgagtttcatgtttatgatgtgaccagcgagttgattaacgatcggttatcggataaa
ggggcggacagttacttggatcaagtattacgcttagacacaaccacattgattgtcgat
gatccggttaagcgagtggataatatgaccatggcttggggcttggaagctcgggttcca
tttttagatcatcatttggtggagctggccatgtcagctccaaccgatcttaaattgaaa
gattttaaatatattctgaaaaagattgctcgaggcattgtgccgaatgaggtgattgat
cgtcctaaggggtatttccctatgccagccttaaagtatgtccgaggccctttttacgaa
atgatgaagtcgattttaaccagtcctcaagcaaaagccagagggattttcaaacccgcg
tatattcaaaagctgttagatcacccagaagcggatgaaagttttacggctattaagggc
agtaaactgtggcatgcggcgttattggaactttggttacagcgacatgttgatccttat
gttcaataa

DBGET integrated database retrieval system