KEGG   Thiomicrospira crunogena: Tcr_0652Help
Entry
Tcr_0652          CDS       T00296                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tcx  Thiomicrospira crunogena
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
728659..729387
Genome map
AA seq 242 aa AA seqDB search
MNPVSVVKRLGLSMMVLAASNQVAADEAAIQKKLNQLIPNAAAANIKESVIPNLYEVSLG
AKIIYMSGDGQYIVNGHIINLDTRENVTEQALNQTRKTELDKLSASTMIVYPAKGEKKRT
ITVFSDIDCPYCRKLHKEIPALNQAGIEVRYMAYPRAGVGSDAYKKAVSVWCAKDSATAM
NDAMTTGQVALKTCQNPVKQHMQQAENFGVTGTPNIIFDSGKMIPGYAPANELIKLLIHK
SS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggtttcagtagttaaacgactaggtctaagcatgatggttttagcggcctcc
aatcaagtggctgcagatgaagcagcaattcaaaaaaaattgaatcaactgattcctaat
gccgcagcagccaatatcaaagaaagtgtcatccctaatttgtatgaagtgtcactaggt
gccaaaattatttacatgagtggggatggtcaatatattgtaaatggtcatatcattaac
cttgatacgcgagaaaatgtgaccgaacaagccttaaatcaaacacgtaaaaccgagctg
gataagctttcggctagtactatgattgtgtaccctgccaaaggcgagaaaaagcgtacc
attacggttttttcagatatcgattgtccttattgccgcaaacttcacaaagagattcca
gcgttgaatcaggccggtattgaggttcgttatatggcttatccacgtgccggagtaggg
tcggatgcttataaaaaggccgtttcagtctggtgtgcaaaagattctgctacagcaatg
aacgatgccatgacaactggtcaggtagccttaaaaacctgtcaaaaccctgtcaaacaa
catatgcagcaagcagagaattttggtgtcacaggcacgccaaacattatatttgattcc
ggaaaaatgattcctggttatgcgccagccaacgaattaattaagttattgattcacaag
tcttcttaa

DBGET integrated database retrieval system