KEGG   Thiomicrospira crunogena: Tcr_0742Help
Entry
Tcr_0742          CDS       T00296                                 

Definition
flagellar biosynthetic protein FliR
Orthology
K02421  
flagellar biosynthetic protein FliR
Organism
tcx  Thiomicrospira crunogena
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:tcx02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
812643..813386
Genome map
AA seq 247 aa AA seqDB search
MGLYFWPFIRISGMLLMVPILSGSYVPMNVRLLLAVFITFAVAPSLALPPPVDPFTWHGI
LLIVQQLGIGVAIGLIFALIFQAFVIAGHLASMSMGLAMASMVDPATGVNTPIIGRYFTI
IATLLFLLMNGHVLVFKAVLQSFETLPIGLHFFTQDSLKLIYGFGSQMFESGVTIALPLV
TALLLVNIAFGVVARAAPALNIFAVGFPVTLLVGLIMLVFITPLLYPNLQILMKATVELL
AQLKLNS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggggctttatttttggccttttatccgtattagcggcatgctattaatggtccctatc
ttgtcgggcagttatgtgccgatgaatgtccgtttgttattggccgtttttattacgttt
gccgttgcgccatcattggctttgccgccaccggttgatccctttacctggcatggtatt
ttgttgattgttcaacagttgggaatcggggttgcgattggattgattttcgcactcatt
tttcaagcgtttgtcatcgcggggcacttggcctccatgtcaatggggttagcgatggcg
agtatggttgatccagcaactggggtgaatacgccaattattgggcggtattttacaatc
atagcaaccctgctgtttttgttgatgaatggccatgtgttggtttttaaagccgttttg
caaagctttgaaactttgccgattgggttgcattttttcacgcaggacagtttgaaattg
atttatgggtttggcagtcaaatgtttgaatccggggtgacgattgcgttgccattggtg
acggctttgcttttggtgaatatcgcatttggggttgttgcgagagcggcgcccgcgtta
aatatttttgctgtagggttcccagtcactttgttggtgggtttgattatgttggtcttt
atcaccccattactgtatccgaacttgcagattttaatgaaagcaaccgttgagttgttg
gcgcaattaaaattaaattcttga

DBGET integrated database retrieval system