KEGG   Thiomicrospira crunogena: Tcr_0758Help
Entry
Tcr_0758          CDS       T00296                                 

Definition
response regulator receiver (CheY-like) modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tcx  Thiomicrospira crunogena
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tcr_0758
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tcr_0758
Enzymes [BR:tcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tcr_0758
Two-component system [BR:tcx02022]
 CheA family
  CheA-CheYBV
   Tcr_0758
Bacterial motility proteins [BR:tcx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tcr_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827154..828284
Genome map
AA seq 376 aa AA seqDB search
MSKIKVLIVDDSALVRQMLQEMLKSDPEIEVVGTASDPYDAREKVKQLHPDVLTLDVEMP
RMDGVTFLKNLMRLHPLPVVMISTLTEKGADITFEALDLGAVDFVAKPKIDLQHTFEDYT
DEICRKVKTASKVSKWQLERQYARYVANKESKPKVLSKPGSLVSKVVEKFTTDAIVPKKA
PSDFSKPSHKVIALGASTGGTEAIKEVLMRLPSTTPAIVITQHIPASFSLPFAQRMNSVS
EMEVTQAEDRQPILAGHVYIAPGDKHLLVERTSSGYICRLNDGPPVNRHKPSVDVMFRTV
VQSVGKNAVGVLLTGMGADGAKGMKELQEIGVPTIVQDEKTCVVWGMPGEAVKLGAADYV
LPLGSIPEKILALIKK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagataaaggtgttaatcgttgacgattctgctttagttaggcaaatgttacaa
gagatgttgaagtcagatccagagattgaagtggtcggcactgcatctgatccttatgat
gcaagagaaaaagttaagcagcttcatccggatgtattgacattggatgtggaaatgcct
cgcatggatggcgtgacgtttttaaaaaatttaatgcgactgcaccctttgccggtggtc
atgatttcaacattgaccgagaaaggggccgatattacgtttgaagcgcttgatttgggc
gcggttgattttgttgcaaaacccaagattgatttacagcatacctttgaagactatacc
gatgaaatctgtcgcaaagtaaaaactgcgtccaaagtttccaaatggcagcttgaaaga
cagtatgcgcgttatgtggccaacaaagaaagcaagcctaaagtgttgtccaagcctggc
tctttggtttctaaggttgttgagaagtttacgacggatgccattgtgcccaaaaaagcg
ccttcggatttctccaagccatcgcataaagtgattgcattgggtgcctcaaccggtggc
acggaagccattaaagaagtgttgatgcgattaccctccacaacgcctgctatcgtgatt
acacagcatattcccgcgtcgtttagtttgccttttgcgcaacgaatgaatagcgtttca
gagatggaagtgacgcaagctgaagatcgtcagcctattttggccgggcatgtttacatt
gctccgggcgataaacacctgttggttgagcgaacctcttccggctacatctgtcgttta
aatgatggtccgccagtcaatcgtcacaaaccgtcggttgatgtgatgttccgtacggtg
gtgcaaagtgtcggaaaaaatgccgtcggtgtgttgttgactggcatgggggccgatggc
gcaaaggggatgaaagagcttcaagaaataggcgtcccgacgattgtccaagatgaaaaa
acatgtgtcgtttgggggatgccgggcgaagcggtcaaacttggcgccgctgactatgtt
ttaccgctgggatcaatccctgaaaaaattctggcactcattaaaaaataa

DBGET integrated database retrieval system