KEGG   Thiomicrospira crunogena: Tcr_0774Help
Entry
Tcr_0774          CDS       T00296                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
tcx  Thiomicrospira crunogena
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tcr_0774
Enzymes [BR:tcx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Tcr_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
844944..846713
Genome map
AA seq 589 aa AA seqDB search
MKEQALSRIKERLHYCYGADDAEVAYQEICDLLQSFSSEQTLPESRWSHEDVMLITYGDT
FQKEGEVPLETLSRFLKTHIKDAINNVHILPFFPYSSDDGFSVIDYTLVNPDLGDWSQVE
AIGESYQLMFDLVVNHISRESLWFTDFKANIPPFNEFFIAMEGTEDVSQVTRPRNTPLLV
PAYTHRGRKMVWATFSADQIDLNFKNPKVLIKMLEVLLLYLEKGAKTIRLDAIAFLWKEL
GSKCIHLPETHQMVKLFRDVMSIVKPESILLTETNVPHLENLSYFGQQDEAHMVYQFALA
PLVLHALHRGDGSYLTEWASTLDAPPKGCTFLNFTASHDGIGVRPVEGILPEREVEDLIT
SMHRLGGFVTTKSNPDGTESPYEINIALFSAFRETYHSNGPDQWQVDRFICSQNIMMTLQ
GIPAFYIHSLVAAPNDREGVEKTGRTRSINRRRWDYDYLQALIESGRTSNAEVLKRLTNI
LQRRKKHKAFHPDVPQHVIDLGQSFFALWRDEEGLRFPLLAIHNLTSEIKLIDLSKIAGI
ERFSYWVNLLDNRGVSSAENNFVLQPYQSVWLMPETVDDVSALWAPFTD
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaagcgttaagtcgaattaaggaaagactccattattgctatggcgcagac
gatgctgaggtcgcctatcaagaaatttgtgacttattgcagtcattctcttctgaacaa
acgcttcccgaatcgcgttggtcgcatgaagatgtcatgctgattacctatggtgacacc
tttcaaaaagaaggtgaggtaccgcttgagacgttatcccgctttttgaaaacgcatatc
aaggatgcgatcaataacgtccatattttgccgttttttccttacagttcggacgatggg
ttttccgtcattgattacaccctggtcaatccggatttgggagattggtcacaggtcgaa
gcgattggtgagtcttatcaattaatgtttgatctggtggtaaaccatatttctcgggag
agtctttggtttaccgattttaaagccaatattccaccgttcaacgagttctttattgcc
atggaaggtaccgaagatgtgtctcaggtgacgcgaccacgaaacacgcctttgttagtg
cctgcctacacgcatcgtggccgaaaaatggtgtgggcgacattcagtgccgaccagatt
gatttgaactttaagaacccaaaagtcctgattaagatgctggaagttttgctgttgtat
ctggaaaaaggggcgaaaacgattcgcctagatgcgattgcgtttttgtggaaggagtta
ggcagcaagtgtattcatttgcctgagacgcaccagatggtgaagttattccgagatgtg
atgtccattgtcaaacctgaaagcattttgctgacggaaaccaatgtgccgcatctggaa
aatttatcttatttcggacagcaggacgaagcacacatggtgtatcaatttgcgttggca
ccgttggtgttgcatgcattgcatcgtggggatggaagttatttaaccgagtgggccagt
accttagatgcgccgccaaaaggctgtacctttttaaactttaccgcgtcacatgatggg
attggggttcgacccgttgagggcattctgccggaacgagaagtggaagatttgattacc
agtatgcaccgtctgggtgggtttgtgacaaccaaatccaacccggatggcacagaatcg
ccttatgaaatcaatatcgcgttattcagtgcatttcgtgaaacatatcattccaatggt
ccggatcaatggcaggtggatcgttttatttgttcacaaaatatcatgatgacgttgcag
ggcattccggctttttatattcacagtttggtggccgctccgaatgaccgtgaaggggtt
gagaaaacgggaagaacacgttctattaaccgtcgtcgctgggattatgattatttacag
gccttgattgaaagcggccgaacttcgaatgcggaagtgttgaaacggttgaccaatatt
ttgcaacgccgtaaaaagcacaaagcgtttcacccggatgttccgcaacatgtgattgat
ttggggcaatcgtttttcgcgttatggcgtgatgaagagggattacgatttccattgttg
gccattcataacttaaccagtgaaattaagctcatcgatttgtctaaaatagccggtatt
gagcgcttctcgtattgggtgaatttattggataatcgaggcgtttccagtgcggaaaac
aactttgtgttgcaaccctatcaatcggtttggttgatgccggaaaccgtggatgacgtg
tctgccctttgggcaccgtttacagattga

DBGET integrated database retrieval system