KEGG   Thiomicrospira crunogena: Tcr_0803Help
Entry
Tcr_0803          CDS       T00296                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcr_0803
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_0803
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcr_0803
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcr_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
875019..876224
Genome map
AA seq 401 aa AA seqDB search
MSIDYSQYPDKKGHFGVYGGIFAPETLMAALEELSQQYESVKNDPAFIAELTQDFQDYVG
RPSPLYYAERWSESLGGAKIYLKREDLNHTGAHKINNTIGQALLAKRLGKKRIIAETGAG
QHGVASATVAARLGLECVVYMGADDIVRQAPNVARMKMLGAEVIGVESGTRTLKDALNEA
MRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFQAVIGREAKQQHLEKEGKLPDALVACVGG
GSNAIGLFYDFLPDESVKIYGVEAGGLGLETGQHAAPLCEGKPGVLHGNRTYLMEDENGQ
ILGTHSISAGLDYPGVGPEHAWLKDIGRAQYVAINDDEAMQGFRDLTKFEGIIPALESSH
ALAYATKLAPTMSKDQTIIVNLSGRGDKDMGTIAKIEGFEI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgattattcgcaatatcctgataaaaaaggacattttggggtttacgggggc
atttttgcacctgaaactctaatggctgcattagaagaattgagccaacaatatgaaagt
gtcaaaaacgacccggcgtttatcgctgagttgactcaagactttcaagattatgttggt
cgtccttcgccgttatattatgcagagcgatggtcagagtcattaggtggtgccaagatt
tacttgaagcgcgaagatttaaatcataccggtgcccacaaaatcaataacaccattggt
caagccttgttggcaaaacgcctaggtaaaaaacgtattatcgctgaaaccggtgcggga
cagcacggggtcgccagtgcaaccgttgcagcacgactgggtcttgaatgtgtggtctat
atgggtgcggatgatatcgttcgtcaagcgccgaatgtggcacgcatgaaaatgttaggc
gctgaagtcatcggggttgaatcgggcacacgtaccttgaaagatgcattaaatgaagcc
atgcgtgattgggtcaccaatgtggatgataccttttacattatcggtacggttgcaggc
ccgcacccgtatccagccatggtacgtgactttcaagcggttattggtcgtgaagccaag
cagcaacatcttgaaaaagaaggtaaattgcctgacgcgttggttgcttgtgttgggggc
ggatcaaatgcgattggccttttttacgatttcttaccggatgaatcggtcaaaatatac
ggcgtagaagctggagggcttggcctggaaacagggcagcacgcagcgccgttatgtgaa
ggaaaacccggtgtactgcacggtaaccgaacctatctaatggaagatgagaatggccag
attttaggaactcactctatttccgctgggttggattacccgggtgtcggtcctgagcat
gcttggttaaaagacattggtcgtgcgcagtatgtggcgattaatgatgatgaagcgatg
caaggctttcgtgatttaacaaaatttgaaggaattatcccagcattggaatcgagtcat
gcattggcctatgcgaccaagctggcgccaaccatgtcaaaagatcagactattattgtc
aatttatcgggtcgtggtgataaagatatggggaccatagcgaaaattgaggggtttgag
atttaa

DBGET integrated database retrieval system