KEGG   Hydrogenovibrio crunogenus: Tcr_0804Help
Entry
Tcr_0804          CDS       T00296                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00260  Glycine, serine and threonine metabolism
tcx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01130  Biosynthesis of antibiotics
tcx01230  Biosynthesis of amino acids
Module
tcx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_0804
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcr_0804
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcr_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABB41400
JGI: Tcr0804
UniProt: Q31HH3
Position
876226..877044
Genome map
AA seq 272 aa AA seqDB search
MSRIDATLSALKSEKKTALIPYITAGDPHPDMTVNLMHSLVEQGADMIELGVPFSDPMAD
GPVIQKAVERALEHNVSLKNVLAYVTEFRKKDAQTPVILMGYLNPIEAMGSDVFAKAAAE
AGVDAVLTVDMPPEESEGYFQDLSLAQLDRIFLVSPTTPDGRLNAVSEKGSGFVYYVSLK
GVTGSKALDVDDVAQHVGHLREKMSMPVAIGFGIRDGNTAYEMAKLGDAIIVGSALVSLI
EQNASEDSAVIQQVLSDKMREFRQAIDKADNE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaattgatgcaacgctgagcgctttgaaatcagaaaaaaagacggctttaatt
ccttacattacagcaggtgatccacaccccgatatgacggtgaatttgatgcacagcttg
gttgaacaaggtgcggatatgattgagctcggtgttcctttctcagacccgatggcggat
ggccctgtcattcaaaaagcggtagaacgagctttagaacataatgttagtttaaaaaat
gttttagcgtatgtgactgaatttcgtaagaaagacgcgcaaacgccagtgattttaatg
gggtatttaaacccgattgaagctatggggagcgatgtgtttgcgaaagcggcagctgaa
gccggagtggatgcggttttgacggtggatatgccgccagaagaaagtgaagggtatttt
caagatttatcacttgcgcaacttgatcgaatttttctcgtctctccgacgacgcctgac
ggacgccttaacgccgtcagcgaaaaaggcagtggatttgtatactatgtctctttaaaa
ggtgtaaccggttccaaagcattggatgtcgacgatgtggctcagcacgttggccattta
agagaaaaaatgtcgatgcctgtggccattggatttggtattcgtgatggcaacacggct
tatgaaatggccaagcttggcgatgccattattgttggttctgcgttggtcagtttgatt
gagcaaaatgcttctgaagactctgctgtgattcaacaggtattaagtgataaaatgcgc
gaattcagacaagcaattgataaagcggataacgaataa

DBGET integrated database retrieval system