KEGG   Thiomicrospira crunogena: Tcr_0804Help
Entry
Tcr_0804          CDS       T00296                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcr_0804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_0804
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcr_0804
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcr_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
876226..877044
Genome map
AA seq 272 aa AA seqDB search
MSRIDATLSALKSEKKTALIPYITAGDPHPDMTVNLMHSLVEQGADMIELGVPFSDPMAD
GPVIQKAVERALEHNVSLKNVLAYVTEFRKKDAQTPVILMGYLNPIEAMGSDVFAKAAAE
AGVDAVLTVDMPPEESEGYFQDLSLAQLDRIFLVSPTTPDGRLNAVSEKGSGFVYYVSLK
GVTGSKALDVDDVAQHVGHLREKMSMPVAIGFGIRDGNTAYEMAKLGDAIIVGSALVSLI
EQNASEDSAVIQQVLSDKMREFRQAIDKADNE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaattgatgcaacgctgagcgctttgaaatcagaaaaaaagacggctttaatt
ccttacattacagcaggtgatccacaccccgatatgacggtgaatttgatgcacagcttg
gttgaacaaggtgcggatatgattgagctcggtgttcctttctcagacccgatggcggat
ggccctgtcattcaaaaagcggtagaacgagctttagaacataatgttagtttaaaaaat
gttttagcgtatgtgactgaatttcgtaagaaagacgcgcaaacgccagtgattttaatg
gggtatttaaacccgattgaagctatggggagcgatgtgtttgcgaaagcggcagctgaa
gccggagtggatgcggttttgacggtggatatgccgccagaagaaagtgaagggtatttt
caagatttatcacttgcgcaacttgatcgaatttttctcgtctctccgacgacgcctgac
ggacgccttaacgccgtcagcgaaaaaggcagtggatttgtatactatgtctctttaaaa
ggtgtaaccggttccaaagcattggatgtcgacgatgtggctcagcacgttggccattta
agagaaaaaatgtcgatgcctgtggccattggatttggtattcgtgatggcaacacggct
tatgaaatggccaagcttggcgatgccattattgttggttctgcgttggtcagtttgatt
gagcaaaatgcttctgaagactctgctgtgattcaacaggtattaagtgataaaatgcgc
gaattcagacaagcaattgataaagcggataacgaataa

DBGET integrated database retrieval system