KEGG   Hydrogenovibrio crunogenus: Tcr_0893Help
Entry
Tcr_0893          CDS       T00296                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tcr_0893
Enzymes [BR:tcx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tcr_0893
DNA repair and recombination proteins [BR:tcx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tcr_0893
    RecFOR pathway proteins
     Tcr_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_2 HHH_3 HHH_8 Transposase_20 DNA_pol_lambd_f 5_3_exonuc BRX_assoc
Motif
Other DBs
NCBI-ProteinID: ABB41489
JGI: Tcr0893
UniProt: Q31H84
Position
972867..973469
Genome map
AA seq 200 aa AA seqDB search
MIGFLSGTLHAKLPPQILINVNGVGYEVEAPMSTFYAIGEVGDEVMLLTHMHVREDAMLL
FGFASELERSLFKELIKVNGIGAKMAIGILSAMSVNDFVGLVDVGDAPALTKIPGVGKKT
AERLVIEMRDRLKGWGNGASSNVSSKTMVSSAPHNQKASAVEALISLGYKTAQADKMVQA
VESGLSLEETIKKALQSVKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgataggatttttatcgggcacattacatgcaaagttacccccacaaattttgattaac
gtcaacggagtggggtatgaagtggaagccccgatgtcgacattttacgccatcggcgaa
gtgggcgatgaggtgatgctgttaacacatatgcatgtgcgtgaagatgcgatgttgttg
tttgggtttgcctcggagcttgaaagaagcttgtttaaagaattaattaaagtgaatggt
attggtgccaaaatggcgattggcattttgtctgccatgtcggtcaatgattttgttggg
ttggttgacgttggcgatgcccccgcgctgacaaaaattccaggggtgggtaagaaaacc
gcggaacgtttggtcattgaaatgcgggatcgtttgaaaggttgggggaacggggcgagt
tcaaacgtttcgtcaaaaacaatggtgagctctgcgccacataatcaaaaggcttcagct
gttgaggcgttgatttcattagggtataaaacagctcaagcagataaaatggtacaagcc
gttgagtccggtttaagtttggaagagacgattaaaaaagcattgcagtccgttaagctc
taa

DBGET integrated database retrieval system