KEGG   Hydrogenovibrio crunogenus: Tcr_0989Help
Entry
Tcr_0989          CDS       T00296                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00340  Histidine metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tcr_0989
Enzymes [BR:tcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tcr_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABB41584
JGI: Tcr0989
UniProt: Q31GY9
Position
1064913..1066214
Genome map
AA seq 433 aa AA seqDB search
MLNIRKLSANADGFKAELEALLAWETVSNDSVNEIVKDVLKNVRERGDEALLEYTAKFDR
LTLAKGSDLEIPKSELEAALKRIPKDQRDGLELSAQRVKDYHEKQVMKSWSYTEDDGTFL
GQQVTCLDRVGLYVPGGKAAYPSSVIMNAIPAKVAGVPELIMVVPTPDGEVNDMVLAAAA
ICGVDRVFTLGGAQAVAALAYGTETVPPVDKVVGPGNIFVATAKREVFGTVGIDMIAGPS
EILVYCDGKTNPDWIAMDLFSQAEHDEDAQSILVTQDAEFAEKVYLSMNKLVKTLPREEI
ITKAITDRGAIIVVDNEDQAIELINYIAPEHLELSIDEPKALLPKIKHAGAIFMGRFTAE
ALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIMCSAEGANMLGQVAGVLADGEGL
QAHAASARYRVKD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatattagaaaattatctgccaatgcagatgggtttaaagctgaattagaagcc
ttgcttgcctgggaaaccgtttctaatgattcagtcaacgaaattgtaaaagatgtgctt
aaaaatgttcgcgaacgaggcgacgaagcattattggaatacaccgctaagtttgatcgt
ttgaccttggcgaaaggatctgaccttgaaattccaaaatcagaacttgaagcggcttta
aagcgtatcccaaaagaccaaagagatgggttggaactttcggcgcaacgtgtcaaagac
tatcacgaaaaacaagtgatgaaatcttggtcttatacggaagatgacggcacttttctt
gggcagcaagtcacatgtcttgatcgtgtcggactatatgttccgggcggaaaagcagcc
tatccttcgtctgtcattatgaacgcaattcccgctaaagtggctggggtgccagagttg
attatggttgtgcctacaccagacggtgaagtcaatgatatggtgctggcggccgcggcg
atttgtggtgtcgatcgagtctttactttaggtggcgcacaagctgtagcggcactggcg
tatggaacggagacagttcctcccgttgataaggttgtgggaccaggtaatatctttgtt
gcgacggcaaaacgagaagtctttggaacggttggaatcgatatgatcgccggtccgtca
gagattctggtgtattgtgacggtaagaccaatccggattggattgcgatggatttattt
tctcaagccgagcatgatgaagatgcccagtctattttagtgacacaagatgcagagttt
gctgaaaaagtgtacctgagtatgaataagctggttaaaacacttccaagagaagaaatt
attaccaaagcgattaccgaccgtggtgcgattattgtggtggataatgaagatcaagcc
attgaactgattaactatattgcaccagagcatttagagctgtccattgatgaaccgaaa
gcgttgttgccaaaaatcaaacatgctggcgcaatcttcatggggcgtttcacggctgag
gcattgggtgattattgcgccgggccgaaccacgtgttgccaacatcaagaaccgcgcgt
ttctcttcaccattaggtgtatacgattttcaaaaacgttcaagcttaatcatgtgttct
gccgaaggggcaaacatgcttggacaggttgcgggtgtcttagccgatggtgaaggcttg
caagcgcatgctgcatctgcgcgttacagagtaaaagattaa

DBGET integrated database retrieval system