KEGG   Thiomicrospira crunogena: Tcr_1069Help
Entry
Tcr_1069          CDS       T00296                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcx  Thiomicrospira crunogena
Brite
Enzymes [BR:tcx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tcr_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1146776..1148779
Genome map
AA seq 667 aa AA seqDB search
MIDFDRTRDLMVNDQIEARGVRDAKVLQAMRTVHREAFVPEDMRDLSYRDSPLPIGAGQT
ISQPYIVGYMIEALGLKGGEKVLEIGGGSGYAAAVLAEIARQVYTVERIEELAEKAAQSL
SQEGYDNVTVISGDGTTGWEEVAPFDAILVSAGAPSIPESLKHQLAIGGRMVVPVGTHKN
VQELVRITRRDQEQFDLEKLADVRFVPLIGEQGWETDPDSSQTTSPRVIQTRPIVNQSLP
NLILQNSEPFQSSEKANLDGLMERIGEAKVVLIGEASHGTSEFYAMRAHITQRLIEEKGF
TVVAAEADWPDAAQIDRYVRHRDASPSEWTAFSRFPTWMWRNTETRDFIDWLHEYNKTLG
AAQRTGFYGLDMYSLFTSINAVVEYLEEFDPDLAEVARWRYGCLSPWEANPAAYGKAALS
DQYQDCENDVAQMLTELYKNRQSYLLNDGERFLDASQNAELVANAERYYRVMYYGSRASW
NLRDQHMFDTLNRVMQARGEETKAIVWAHNSHIGDASATEMSKRGEHNIGQLCRQTFGEA
SYRIGFGTDHGTVAAASNWDQPMEIKQVQPSHSQSYENLFHQTEQAGLILPLRHNSNSQL
IQELNKPRLERAIGVIYRPETELASHYFEAVLPLQFDEYIWIDKTQAVTPLTTEEISGMP
DTYPFGV
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgatagaacacgtgatttgatggtcaatgatcaaatcgaagcgcgtggc
gttcgcgatgccaaggtgttgcaagcaatgcgaaccgttcatcgagaagcgtttgtgcct
gaagacatgcgagatttgagttatcgtgattcacctttaccgataggagccgggcaaacc
atctcgcaaccctatatcgtgggctatatgattgaagcgttgggattaaaagggggagag
aaggttctcgaaattggaggaggatcaggctatgccgctgccgtactagctgaaatcgcc
cgtcaggtgtatacggtggaacgcattgaggaactggccgaaaaagccgcccaaagcctc
tctcaggaagggtatgacaatgtgacggtcatcagcggagatggcacgacagggtgggaa
gaggtcgctccctttgacgccatcttggtgtcggctggcgcgccgagcattccagagagt
cttaagcatcaactcgccattggcgggcgcatggtggttcctgtcgggacgcacaaaaac
gttcaagaactggttcgaataacacgccgagatcaagagcaatttgatctggaaaaattg
gcggatgttcgtttcgttcctctaatcggtgaacagggatgggaaaccgaccctgattca
tctcaaacaaccagtcctcgcgttattcaaaccagaccgattgtcaatcaatcgttacct
aacctcattctacaaaacagcgaaccgtttcaatcctcagaaaaggcaaacctagacggt
ttgatggaacgtataggggaggccaaagtggttttgattggggaggccagtcacggcacg
tcagaattctacgccatgcgtgcacatattacccaacggttaattgaagagaaaggcttt
acggtcgtggccgccgaagccgattggcctgatgccgctcagattgatcgttatgtccgt
caccgagatgcgtctccttctgaatggacggctttctcccgttttccgacttggatgtgg
cgcaatacggaaacgcgcgattttatcgactggctgcatgaatacaataaaacattgggt
gcagcacagcgcaccggcttttatgggttggatatgtacagtctattcacgtccattaac
gcagtggtggaatatttagaggaatttgatccagacttggcagaagtggcacgttggcga
tatggctgtttaagtccatgggaagcaaatccggcggcttatggcaaagcggcattgagt
gaccagtaccaagattgtgaaaacgatgtcgcgcagatgttgacggagttatacaaaaat
cgtcaatcgtatctgcttaatgatggagagcgttttttagacgccagtcaaaatgccgaa
ttggtcgccaatgcagaacgttactatcgtgttatgtattacggttctcgcgcctcgtgg
aatttacgggatcaacatatgttcgatactttaaatcgtgttatgcaggcgcggggagaa
gagacgaaagccattgtttgggcgcataattctcatatcggtgacgcttccgccacggaa
atgtcgaaacgcggtgagcataatattgggcagttgtgtcgtcaaacgtttggcgaggcc
tcttatcgaatcggttttggaaccgatcatggcaccgtggccgctgcgtccaactgggat
caacctatggaaattaaacaggttcagccgtcccattcgcaaagttatgaaaaccttttt
catcaaaccgagcaggccgggttgattctgcctttacggcacaattcaaactctcaattg
attcaggaattgaataaacctcgattggagcgcgctattggcgtgatttatcgtccggaa
accgagctcgccagtcattatttcgaagcggtcttaccccttcagtttgatgagtacatc
tggattgataaaacacaagcggttacgcctttgaccaccgaagaaatcagcggaatgccc
gatacatatccattcggtgtttaa

DBGET integrated database retrieval system