KEGG   Hydrogenovibrio crunogenus: Tcr_1116Help
Entry
Tcr_1116          CDS       T00296                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00010  Glycolysis / Gluconeogenesis
tcx00620  Pyruvate metabolism
tcx00640  Propanoate metabolism
tcx00680  Methane metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
tcx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_1116
   00620 Pyruvate metabolism
    Tcr_1116
   00640 Propanoate metabolism
    Tcr_1116
  Energy metabolism
   00680 Methane metabolism
    Tcr_1116
Enzymes [BR:tcx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tcr_1116
Lipid biosynthesis proteins [BR:tcx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tcr_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB41711
JGI: Tcr1116
UniProt: Q31GL2
Position
1202751..1204712
Genome map
AA seq 653 aa AA seqDB search
MSNNIESVLQENRVFKPTEAFKKQANITEEKYQQLKKKASEDYEGFWSDLAKEKLSWSKD
FTVGLDDSNPPFYKWFSDGELNASYNCIDRHLAEKEDKLAIIFEADDGTVEQYTYKDLHD
EVCRLANALTAQGIEKGDRVVIYMPMIPQAVFAMQACARIGAIHSIVFGGFSAEALRDRI
EDAGAKMVITANAGRRGGKSVPLKGAVDEALEKGGNSVRKVIVYKRTDDDVKMKDDRDIS
WHDAVAGMSNYHDAVMVNAEHPLFLLYTSGSTGKPKGIQHSTGGYLLNAHITNEWVFDLK
DSDVFWCTADVGWITGHTYVAYGPLSMGMTMLMFEGVPTYPDAGRFWQVCQDHGVTVFYT
APTAIRALMKFGDDLPKQYDLSKLRLLGTVGEPINPEAWMWYHEVIGRGECPIMDTWWQT
ETGAHMIAPIPGVTDLKPGSCTKPLPGIDAHIVDEEGKELTHGEGGYLVIRKPWPSMVRT
IWGDDERFVDTYFAMFKNKYYVVGDSAHLDTDGNFWIMGRIDDVLNVSGHRLGTMEIESA
LVSHEKVAEAAVVGKPHDVKGESVFAFVVLNQEIPEGDARLAMVQELRNHVAKEIGPIAK
PDDIRFGSNLPKTRSGKIMRRLLRSIAKGEEITSDTSTLEDPSILDQFMQPNK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacaacattgaatcggttttgcaagaaaaccgagtgttcaaacctaccgaagcc
tttaagaaacaggcaaatattactgaagaaaaatatcagcaattgaagaaaaaggcctct
gaagactatgaaggtttttggtctgacttagccaaagaaaagctcagttggtctaaagac
tttacggttgggttggatgactcaaatcctcctttttataaatggttttctgatggtgag
ttgaacgcttcctataattgtattgatcgccatttagctgaaaaagaagacaagttagcg
attatcttcgaagccgatgatgggacagtagaacaatatacctataaagatttacatgac
gaagtctgccgtttagcaaatgcattgacagcacagggcattgaaaaaggggatcgtgtt
gttatctatatgccgatgattccacaagccgtgtttgcaatgcaggcctgcgcccgtatt
ggtgcaattcactcaattgtttttggtggtttctctgcagaagccttgcgtgatcgtatt
gaagatgcgggcgctaaaatggtaattactgcaaatgcgggacgccgaggtggaaaatcg
gttccattaaaaggtgcggtagatgaagcactggagaaaggtggaaattccgttcgtaaa
gtcatcgtttataaacgcaccgacgatgacgtcaagatgaaagatgaccgtgacatttca
tggcatgatgcggttgccggaatgagtaactatcatgatgcggtcatggtgaatgcagag
catcctctgtttttgctgtacacttcaggctccacaggaaagccgaaaggtattcagcac
agtacaggcggataccttttaaatgcgcacattaccaatgaatgggtgtttgatttaaaa
gacagtgatgtgttctggtgtacagccgatgtgggttggatcactgggcacacttatgtt
gcgtatggtccgctttccatggggatgaccatgctgatgtttgaaggggttccaacgtac
ccagatgcaggacgtttctggcaagtttgtcaagatcatggcgttacggtgttttatacc
gcaccaacagccatccgtgcattgatgaagtttggagacgacttaccgaaacaatacgac
ttatctaaactaagactgctaggaacggtaggtgagccaattaatccagaagcctggatg
tggtatcacgaagtgattggtcgtggcgaatgcccgattatggatacctggtggcagaca
gaaacgggtgctcatatgattgcgcctattcctggtgtgacggatttgaagcctgggtct
tgtaccaagcccttaccagggattgatgctcatatcgtggatgaagaagggaaagagtta
acccatggtgaaggtggttatctggtgattcgtaagccgtggccttccatggttagaact
atttggggcgatgacgaacgctttgtagacacttacttcgcgatgtttaaaaacaagtat
tatgttgttggagacagtgcgcatttagatacagatggtaatttctggatcatgggtcgt
atcgacgacgtattgaatgtgtcgggtcatcgtttaggaacaatggaaattgaatccgca
ttggtgtctcatgaaaaagttgctgaggccgccgtggttggtaaaccacatgatgttaaa
ggggaatccgtttttgctttcgtggtgttgaatcaagaaattccagaaggggatgctcgt
ctagccatggtgcaagagctgcgtaatcatgtggcgaaagaaatcgggcccattgcgaaa
cctgatgacatccgttttggctcaaacttgccgaaaacccgatccggtaaaattatgcgc
cgtctattaagaagtattgctaaaggagaggaaattacatcagatacctctactttggaa
gatccgagcattttggaccagtttatgcaacctaataaataa

DBGET integrated database retrieval system