KEGG   Thiomicrospira crunogena: Tcr_1249Help
Entry
Tcr_1249          CDS       T00296                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tcr_1249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_1249
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tcr_1249
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tcr_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1364133..1365608)
Genome map
AA seq 491 aa AA seqDB search
MNFIETRGNDGQRAPSITFSQAILSPMSSFGGIYSPESLPVFDAEFLNSHVDSGYKKLAK
DVLSLFEVDIDESVIDEALSLYDQFDDPSNPVPVVKVYDDLYVSELYHGPTRAFKDMALQ
PFGKVLSSVAQSNQEKYLILAATSGDTGPAALETFKNRDNVQVVCLYPDGGTSDVQRLQM
VTEDADNLKVIGIHGDFDDAQTALKTLLVSDTFRDKLKENHISLSAANSVNFGRIIFQTI
YHIYSYLELVRVKAIQMGEQVYLNVPSGNFGNALGGYYAYKMGLPVKQIHIASNQNNVLT
HFIKTGQYDLRDASVIPTTSPAMDILKSSNIERILFDLFGAERTKELMLKLDTDKYYALT
GAELKEIQGIFAADFCTDEEGKQYIREAFNEGYLMCPHTATCFKPYHTCREDESIKTIAY
STAEWTKFSPVIADALTGQKFEHDRDALEMISEKANVKIPDQISALFDKEITQKTVIDKT
DIEQEILNFLG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattgaaacgcgtggtaatgacggtcaaagagcgccatcgattactttttca
caagctattttaagtccaatgtcctcttttggtggtatttattcgcctgaatcgttaccg
gtatttgatgccgaatttttaaacagtcatgttgattccggttataaaaaattagcgaaa
gatgttctaagtttgtttgaagtggacattgatgagagcgtcattgatgaggcgctgagc
ctgtacgaccaatttgatgatccgagtaatcctgtaccggttgtgaaagtgtacgatgat
ttgtatgtcagtgagttgtatcatggcccaacgcgtgcgtttaaagatatggcgttacaa
ccatttggtaaagtgctgtcttccgtggcgcaatcgaatcaagaaaaatatctgatactg
gcggcaaccagtggtgatactgggcctgccgcattggaaacctttaaaaaccgtgataac
gttcaagtggtttgtttgtatccggatggtggaacgtccgatgtacagcgtttgcaaatg
gtgacagaagatgcggataatctaaaagtcattgggattcatggcgattttgatgatgcg
caaacggccttgaaaacgttgttagtctcagacacgttccgagataaattaaaagaaaac
catatttcgttgtccgctgcgaactcggttaactttggccgcattattttccaaaccatt
tatcatatttacagttacctggagctggttcgcgttaaagccattcagatgggtgaacag
gtttatctgaacgtccctagtggtaactttggaaatgcgttaggtggctactatgcttat
aaaatgggcttgccggttaagcagatccacatcgcttccaatcaaaataatgtgctgacg
cactttattaaaacgggtcaatatgacttgcgcgatgcatcggtcattccaacgacatcg
cctgcaatggatatcctgaagtcatccaacattgaacgtatcttatttgatctgtttggg
gctgaaagaacaaaagagttgatgctgaagttggatacggataagtattacgcattgaca
ggcgcggaactgaaagagattcagggcatttttgcagccgatttctgtaccgatgaagag
ggcaagcagtatattcgtgaagcgtttaatgaaggctatttaatgtgtccacacaccgcg
acgtgttttaagccttatcatacctgccgtgaggatgagtccattaaaacaattgcctac
tcgacggctgaatggacaaagttctcaccggtgattgccgatgcgttaacagggcagaaa
tttgaacatgaccgtgatgcgttggaaatgatttcagaaaaagccaacgtaaagattcca
gatcaaatttcagctttgtttgataaagaaatcactcaaaagacggttattgataaaacg
gatattgaacaagaaattcttaacttcttgggttag

DBGET integrated database retrieval system