KEGG   Hydrogenovibrio crunogenus: Tcr_1249Help
Entry
Tcr_1249          CDS       T00296                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00260  Glycine, serine and threonine metabolism
tcx00750  Vitamin B6 metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01230  Biosynthesis of amino acids
Module
tcx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_1249
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tcr_1249
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tcr_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N DUF4170
Motif
Other DBs
NCBI-ProteinID: ABB41844
JGI: Tcr1249
UniProt: Q31G79
Position
complement(1364133..1365608)
Genome map
AA seq 491 aa AA seqDB search
MNFIETRGNDGQRAPSITFSQAILSPMSSFGGIYSPESLPVFDAEFLNSHVDSGYKKLAK
DVLSLFEVDIDESVIDEALSLYDQFDDPSNPVPVVKVYDDLYVSELYHGPTRAFKDMALQ
PFGKVLSSVAQSNQEKYLILAATSGDTGPAALETFKNRDNVQVVCLYPDGGTSDVQRLQM
VTEDADNLKVIGIHGDFDDAQTALKTLLVSDTFRDKLKENHISLSAANSVNFGRIIFQTI
YHIYSYLELVRVKAIQMGEQVYLNVPSGNFGNALGGYYAYKMGLPVKQIHIASNQNNVLT
HFIKTGQYDLRDASVIPTTSPAMDILKSSNIERILFDLFGAERTKELMLKLDTDKYYALT
GAELKEIQGIFAADFCTDEEGKQYIREAFNEGYLMCPHTATCFKPYHTCREDESIKTIAY
STAEWTKFSPVIADALTGQKFEHDRDALEMISEKANVKIPDQISALFDKEITQKTVIDKT
DIEQEILNFLG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattgaaacgcgtggtaatgacggtcaaagagcgccatcgattactttttca
caagctattttaagtccaatgtcctcttttggtggtatttattcgcctgaatcgttaccg
gtatttgatgccgaatttttaaacagtcatgttgattccggttataaaaaattagcgaaa
gatgttctaagtttgtttgaagtggacattgatgagagcgtcattgatgaggcgctgagc
ctgtacgaccaatttgatgatccgagtaatcctgtaccggttgtgaaagtgtacgatgat
ttgtatgtcagtgagttgtatcatggcccaacgcgtgcgtttaaagatatggcgttacaa
ccatttggtaaagtgctgtcttccgtggcgcaatcgaatcaagaaaaatatctgatactg
gcggcaaccagtggtgatactgggcctgccgcattggaaacctttaaaaaccgtgataac
gttcaagtggtttgtttgtatccggatggtggaacgtccgatgtacagcgtttgcaaatg
gtgacagaagatgcggataatctaaaagtcattgggattcatggcgattttgatgatgcg
caaacggccttgaaaacgttgttagtctcagacacgttccgagataaattaaaagaaaac
catatttcgttgtccgctgcgaactcggttaactttggccgcattattttccaaaccatt
tatcatatttacagttacctggagctggttcgcgttaaagccattcagatgggtgaacag
gtttatctgaacgtccctagtggtaactttggaaatgcgttaggtggctactatgcttat
aaaatgggcttgccggttaagcagatccacatcgcttccaatcaaaataatgtgctgacg
cactttattaaaacgggtcaatatgacttgcgcgatgcatcggtcattccaacgacatcg
cctgcaatggatatcctgaagtcatccaacattgaacgtatcttatttgatctgtttggg
gctgaaagaacaaaagagttgatgctgaagttggatacggataagtattacgcattgaca
ggcgcggaactgaaagagattcagggcatttttgcagccgatttctgtaccgatgaagag
ggcaagcagtatattcgtgaagcgtttaatgaaggctatttaatgtgtccacacaccgcg
acgtgttttaagccttatcatacctgccgtgaggatgagtccattaaaacaattgcctac
tcgacggctgaatggacaaagttctcaccggtgattgccgatgcgttaacagggcagaaa
tttgaacatgaccgtgatgcgttggaaatgatttcagaaaaagccaacgtaaagattcca
gatcaaatttcagctttgtttgataaagaaatcactcaaaagacggttattgataaaacg
gatattgaacaagaaattcttaacttcttgggttag

DBGET integrated database retrieval system