KEGG   Hydrogenovibrio crunogenus: Tcr_1256Help
Entry
Tcr_1256          CDS       T00296                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcx  Hydrogenovibrio crunogenus
Brite
Enzymes [BR:tcx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tcr_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GidB Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_32 Methyltransf_9 TehB
Motif
Other DBs
NCBI-ProteinID: ABB41851
JGI: Tcr1256
UniProt: Q31G72
Position
complement(1371425..1372123)
Genome map
AA seq 232 aa AA seqDB search
MSILQDPVHYPNHAYEANQGVGMTSQRTRNRLVERLIFLGITDPDVLNAVRVTPRHLFLD
EAMASRAYEDTALPIGYSQTISQPWVVAKMSSWLNAKGSLDKVLDIGTGSGYQAAILALL
ARQVYTIERIEPLLVKAEQVLQKLELENVMFSLADGYWGLPSYAPFDGILSAASPESVPE
ELFDQLVENGRLVMPIGSEEQLLYGYVKTSTGYTEECLGEVMFVPMLKGIES
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttacaagacccggtgcattatccaaaccacgcttatgaagccaaccagggt
gttggaatgacttcgcaacgtactcgaaatcgattggttgaacgattgatttttttaggc
attaccgaccctgacgtgctcaatgcggtgagagtgacgcctcgccatttgtttttagat
gaagcgatggccagccgagcttatgaagacaccgcgctgccgattgggtattctcagacc
atctctcagccttgggttgtggctaaaatgtcttcctggttgaatgccaaaggttcttta
gataaagtactggatatcggcactgggtcaggttatcaagcggctattttggctttattg
gctagacaggtctataccatcgaacggatcgaacctcttttagttaaagccgaacaggtt
ttgcaaaagcttgaacttgaaaatgttatgttttcgctagcggatgggtactggggatta
ccttcttatgcaccttttgatggtattttgtctgccgcttctccggaaagcgtgcctgaa
gagttgttcgaccaactggttgaaaatggtcgattggtaatgcccattggctctgaagag
caacttctatatggttatgtcaaaacatccaccggctatacagaagaatgtttgggggaa
gtcatgtttgtcccaatgttgaaaggcatcgagtcttaa

DBGET integrated database retrieval system