KEGG   Thiomicrospira crunogena: Tcr_1374Help
Entry
Tcr_1374          CDS       T00296                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tcx  Thiomicrospira crunogena
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcr_1374
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcr_1374
   00640 Propanoate metabolism
    Tcr_1374
   00660 C5-Branched dibasic acid metabolism
    Tcr_1374
Enzymes [BR:tcx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tcr_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1489457..1490629)
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQAKSLFQQYGIPVPKGVMINDLADLDAALGQIDSKGWVVKAQIHAGARGKAGGV
KLVETAEEAEQAASELLGSSLATIQTAGKALPINALLIEQTLDIYQEFYLSLMVDRVTKT
HTFVISAAGGMDIELVAEASPEKILSVHVDPTVGLMPYQCREIAFALGLTGTAFKQMASV
MQGFYQLALDKDVSLLEINPLVLTAENELVALDAKVNIDSNALYRQPGLVEMRDISQEDV
REAKAADHQLNYIALDGNIGCMVNGAGLAMATMDLIKLNGGEPANFLDVGGGATPERVAE
AFKLILSSSDVQSILVNIFGGIVRCDLIADGIIQAVQEVGLTIPVVVRLEGTNVTLGKEK
LANSGLSIITADGLADAAEKVVAVALEANQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagcaaaatcactgtttcagcagtatggtatccctgttcca
aaaggggtaatgattaacgacttggcagatctcgatgctgcactcggtcaaattgattca
aaaggctgggttgttaaagctcaaattcatgccggtgcgcgaggcaaagcaggaggggtt
aagcttgttgaaacggcagaagaagctgagcaggcggcgtcagagttgctaggcagttca
ttggcaaccattcagaccgcgggtaaggctctgccgattaatgcgctgttgattgagcaa
acgttagacatttatcaagagttttatcttagcttgatggttgatcgtgtcactaaaacg
catacctttgtgatttctgcagcgggtggaatggacattgaattggttgcagaagcgtca
ccagaaaagattctatccgttcatgttgatcctaccgttggcctaatgccttatcagtgt
cgtgaaatcgcctttgcactaggattgactgggacggcatttaaacaaatggcatcagtc
atgcaaggcttttatcagttggcattagacaaagatgtttctttgttggaaattaaccca
ttggttttgacggctgaaaacgagttggtggctttggatgccaaggtgaatattgattcc
aatgctctttatcgtcagccaggcctggttgaaatgcgtgatatttctcaagaagatgtg
cgtgaagcaaaagcagcagaccaccaattaaactatatcgcactggatggcaacattggc
tgtatggtgaatggggctggtttggccatggcgacaatggatttaattaaactgaacggc
ggtgaaccggccaactttttagatgtaggaggcggtgcgacgccagaacgtgttgctgaa
gcttttaaattgattctatcgtcctctgacgttcaatccattttagtgaatatttttggt
gggattgtgcgctgcgatttaattgcagatggcattattcaagccgtacaagaagttggg
ttaacgattccggtggtcgttcgattagaaggaacgaatgtgacattaggaaaagaaaag
ttagcaaacagtggattaagtattatcacggctgatggtcttgcggatgcagcagaaaaa
gtcgttgccgtcgctttggaggccaatcaatga

DBGET integrated database retrieval system