KEGG   Thiomicrospira crunogena: Tcr_1583Help
Entry
Tcr_1583          CDS       T00296                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcr_1583
   01230 Biosynthesis of amino acids
    Tcr_1583
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_1583
   00030 Pentose phosphate pathway
    Tcr_1583
   00051 Fructose and mannose metabolism
    Tcr_1583
   00052 Galactose metabolism
    Tcr_1583
  Energy metabolism
   00680 Methane metabolism
    Tcr_1583
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tcr_1583
Protein phosphatases and associated proteins [BR:tcx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tcr_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1732419..1733693
Genome map
AA seq 424 aa AA seqDB search
MSHPKNVIYAQAGGVTAVINASAAGVIEMTRRHPETFGKTYAAINGIVGVLEERMVDTSE
LGEATLDRLKTQPGAAFQACRFDLDTIEENPAQYERVLEVFRAYDIGYFFYNGGNGSMLT
AQKVADYCSDHGHPVTCIGVAKTIDNDLALSHCSPGFGSAAKYIATSLLEATLDLFSMHN
TSTRFFVLEAMGRNTGWLTIAGGLIKTVLPDVPLIVLPAERAFDQKAFLERVKTLIATRG
YCVCIVSEGLTDSDGNYISIENIEHTQHNDYTQLGGVAHSLSSLVANTFNCKTHSAVPDY
LQRSASHMVSETDWEMAYRAGKAAVQAALDGHHGVLPTIDVISQSPLVWRYQNVDLYQVA
ELEKRVPDAFLTEDGMDITQEAIEYLQPLIKGERPVKFHNGLPDIAPIHFDLVPPTLSAY
KAIK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaccctaaaaatgtgatttatgctcaagcaggcggcgtcaccgcggtcattaat
gccagcgcggccggcgtgatcgaaatgaccagacgtcaccctgaaacatttggaaagacc
tacgccgcaattaacggcattgtcggcgtgctggaagaacgcatggtcgatacctcagaa
cttggtgaagcgacgctcgaccgcttgaaaacacaaccaggggccgcttttcaagcctgc
cgttttgacttggacaccattgaagaaaaccctgcgcaatatgaacgcgtattagaggtc
tttcgagcctatgacatcggttacttcttttataatggtggcaatggctccatgctaacg
gctcaaaaagtcgccgattattgttcagaccatgggcaccctgttacctgcatcggcgtt
gcaaaaaccatcgacaatgatttagcgttatcacactgcagccctggttttggcagtgcg
gccaaatacattgccacgagcctattggaagcgacgcttgatttattttccatgcacaat
acctcgacgcggttttttgttttagaggctatgggccgaaacacaggttggcttaccatt
gcgggtgggttaataaaaaccgtgttaccggacgtccctctcattgtgctgcctgctgaa
cgcgcttttgatcaaaaggcgtttctggaacgcgtcaaaacattgattgcaacccgagga
tattgcgtctgtattgtttccgaaggcctaactgattccgatggcaactacatttcaatt
gaaaacatcgaacacacccaacacaatgattacactcaactgggaggcgttgcccactct
ttatcgagtttagtggcgaacactttcaactgtaaaacccacagcgcggtgcccgactac
ctgcaacgctcggctagccacatggtctcggaaaccgactgggaaatggcctatcgagcg
ggtaaagcggccgttcaagcggctttagatggacaccatggcgttttacccacaattgat
gtcatcagtcagtctccactcgtttggcgttatcaaaatgtagatttgtaccaagtggcc
gaactggaaaaacgcgtgccggatgcctttttaaccgaggatggcatggatattacacaa
gaggccattgagtatcttcaaccgctaattaaaggcgaaagaccggtcaaattccataat
gggttaccggatatcgcaccaatccactttgacttggttcccccaacgctttcggcctat
aaagccattaaataa

DBGET integrated database retrieval system