KEGG   Hydrogenovibrio crunogenus: Tcr_1583Help
Entry
Tcr_1583          CDS       T00296                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00010  Glycolysis / Gluconeogenesis
tcx00030  Pentose phosphate pathway
tcx00051  Fructose and mannose metabolism
tcx00052  Galactose metabolism
tcx00680  Methane metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_1583
   00030 Pentose phosphate pathway
    Tcr_1583
   00051 Fructose and mannose metabolism
    Tcr_1583
   00052 Galactose metabolism
    Tcr_1583
  Energy metabolism
   00680 Methane metabolism
    Tcr_1583
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tcr_1583
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tcr_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABB42175
JGI: Tcr1583
UniProt: Q31F98
Position
1732419..1733693
Genome map
AA seq 424 aa AA seqDB search
MSHPKNVIYAQAGGVTAVINASAAGVIEMTRRHPETFGKTYAAINGIVGVLEERMVDTSE
LGEATLDRLKTQPGAAFQACRFDLDTIEENPAQYERVLEVFRAYDIGYFFYNGGNGSMLT
AQKVADYCSDHGHPVTCIGVAKTIDNDLALSHCSPGFGSAAKYIATSLLEATLDLFSMHN
TSTRFFVLEAMGRNTGWLTIAGGLIKTVLPDVPLIVLPAERAFDQKAFLERVKTLIATRG
YCVCIVSEGLTDSDGNYISIENIEHTQHNDYTQLGGVAHSLSSLVANTFNCKTHSAVPDY
LQRSASHMVSETDWEMAYRAGKAAVQAALDGHHGVLPTIDVISQSPLVWRYQNVDLYQVA
ELEKRVPDAFLTEDGMDITQEAIEYLQPLIKGERPVKFHNGLPDIAPIHFDLVPPTLSAY
KAIK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaccctaaaaatgtgatttatgctcaagcaggcggcgtcaccgcggtcattaat
gccagcgcggccggcgtgatcgaaatgaccagacgtcaccctgaaacatttggaaagacc
tacgccgcaattaacggcattgtcggcgtgctggaagaacgcatggtcgatacctcagaa
cttggtgaagcgacgctcgaccgcttgaaaacacaaccaggggccgcttttcaagcctgc
cgttttgacttggacaccattgaagaaaaccctgcgcaatatgaacgcgtattagaggtc
tttcgagcctatgacatcggttacttcttttataatggtggcaatggctccatgctaacg
gctcaaaaagtcgccgattattgttcagaccatgggcaccctgttacctgcatcggcgtt
gcaaaaaccatcgacaatgatttagcgttatcacactgcagccctggttttggcagtgcg
gccaaatacattgccacgagcctattggaagcgacgcttgatttattttccatgcacaat
acctcgacgcggttttttgttttagaggctatgggccgaaacacaggttggcttaccatt
gcgggtgggttaataaaaaccgtgttaccggacgtccctctcattgtgctgcctgctgaa
cgcgcttttgatcaaaaggcgtttctggaacgcgtcaaaacattgattgcaacccgagga
tattgcgtctgtattgtttccgaaggcctaactgattccgatggcaactacatttcaatt
gaaaacatcgaacacacccaacacaatgattacactcaactgggaggcgttgcccactct
ttatcgagtttagtggcgaacactttcaactgtaaaacccacagcgcggtgcccgactac
ctgcaacgctcggctagccacatggtctcggaaaccgactgggaaatggcctatcgagcg
ggtaaagcggccgttcaagcggctttagatggacaccatggcgttttacccacaattgat
gtcatcagtcagtctccactcgtttggcgttatcaaaatgtagatttgtaccaagtggcc
gaactggaaaaacgcgtgccggatgcctttttaaccgaggatggcatggatattacacaa
gaggccattgagtatcttcaaccgctaattaaaggcgaaagaccggtcaaattccataat
gggttaccggatatcgcaccaatccactttgacttggttcccccaacgctttcggcctat
aaagccattaaataa

DBGET integrated database retrieval system