KEGG   Hydrogenovibrio crunogenus: Tcr_1677Help
Entry
Tcr_1677          CDS       T00296                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00010  Glycolysis / Gluconeogenesis
tcx00030  Pentose phosphate pathway
tcx00051  Fructose and mannose metabolism
tcx00052  Galactose metabolism
tcx00230  Purine metabolism
tcx00500  Starch and sucrose metabolism
tcx00520  Amino sugar and nucleotide sugar metabolism
tcx00521  Streptomycin biosynthesis
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_1677
   00030 Pentose phosphate pathway
    Tcr_1677
   00051 Fructose and mannose metabolism
    Tcr_1677
   00052 Galactose metabolism
    Tcr_1677
   00500 Starch and sucrose metabolism
    Tcr_1677
   00520 Amino sugar and nucleotide sugar metabolism
    Tcr_1677
  Nucleotide metabolism
   00230 Purine metabolism
    Tcr_1677
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tcr_1677
Enzymes [BR:tcx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tcr_1677
    5.4.2.8  phosphomannomutase
     Tcr_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV CCDC117
Motif
Other DBs
NCBI-ProteinID: ABB42269
JGI: Tcr1677
UniProt: Q31F04
Position
complement(1830317..1831690)
Genome map
AA seq 457 aa AA seqDB search
MDDNIKSLSSFKAYDIRGKVPEDLNETLAYKIGKAYVAELGAKRVVVGYDIRLESQSLAD
ALKKGLTEAGADVLDIGLCGTEEVYFSTFYHKTDGGIMITASHNPKGYNGMKLVASGSKP
ISGDTGLKEIERRVIEEDFKHSESTQNQPGLVISETDKSAYIDHLLSYVDLSKLKPLKIV
MDAGNGSAGAVIKQISERLPFKCFFVNEVPDGNFPNGVPNPLLPENRSTTSDAVKQHQAD
FGVAWDGDFDRCFLFDENGDFIEGYYLVGLLAETLLAKNPGEKVIHDPRLTWNTIDQVQQ
AGGVPVQSKTGHAFIKERMRLEDAIYGGEMSAHHYFKDFAYCDSGMIPWLLIAELMSKTG
KSLSSLVSERMQAYPCSGEINYTVNDVPAVLEKVMTHFASQNPRIDKTDGVSLEFDDWRM
NIRASNTEPLLRLNVETKEDKSLVWSKVKEIEKLIET
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggacgataatataaaatctctgtctagctttaaagcctatgatattcgaggaaaagtt
ccagaagacttaaatgaaactctggcttataaaataggcaaagcttatgtagctgagttg
ggtgcaaaaagggtagtggttggttatgacatacgtttagaaagccaaagcttggcagat
gcgttaaagaaaggtttaactgaagcgggtgcagatgttttggatattggcttatgtggt
acagaagaagtctatttttcgactttttatcacaaaacggatggtgggatcatgattaca
gcaagtcataatcctaaaggctataatggcatgaagttagttgcttcaggttcaaaaccc
atttctggagacacaggcttaaaagaaattgagcgtcgagtgattgaagaagattttaaa
cactctgaaagtacgcaaaatcaaccaggcctggtgatttctgaaactgataagtctgct
tatattgatcatttactttcttacgttgatttgtcgaaattaaaaccattgaaaattgtc
atggatgcaggtaatggttctgcgggcgcggtgataaaacaaatttctgaaaggttaccc
tttaagtgcttttttgtaaatgaagtgccagatgggaattttccaaatggtgtgccaaac
cctcttcttccagaaaatagaagcacaacctctgatgcagtaaaacaacaccaagctgat
tttggtgttgcttgggatggcgactttgaccgctgttttttgtttgatgaaaacggtgat
tttattgaaggctactatctggttggactgctggctgaaacacttttggccaaaaatcct
ggagaaaaagtcattcatgacccacgtttgacatggaatacaattgatcaggtgcaacaa
gcgggaggggttccggttcaatccaaaacaggtcatgcctttatcaaagagcgtatgcga
ctggaggatgctatttatggtggggagatgtcagcacaccattactttaaagattttgcg
tattgtgattcagggatgattccatggttattgattgcagagttaatgagcaaaactggg
aagtcattatcttctttagtaagtgagcgaatgcaagcttacccatgtagtggcgagatt
aactacactgtcaatgatgtgcctgctgtattagaaaaagttatgacacattttgcttcg
caaaacccgcgaatagataaaaccgatggtgtgagcttggaatttgatgattggcgcatg
aatattcgtgcttctaatacggaaccgttgttaagattaaatgtagagactaaagaggat
aaatctttagtttggagtaaggttaaagaaatagaaaagctaatagaaacttaa

DBGET integrated database retrieval system