KEGG   Hydrogenovibrio crunogenus: Tcr_1686Help
Entry
Tcr_1686          CDS       T00296                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00521  Streptomycin biosynthesis
tcx00523  Polyketide sugar unit biosynthesis
tcx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tcr_1686
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tcr_1686
Enzymes [BR:tcx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Tcr_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABB42278
JGI: Tcr1686
UniProt: Q31EZ5
Position
complement(1840545..1841072)
Genome map
AA seq 175 aa AA seqDB search
MIITPTPIDGVFEIENKVFEDFRGKFVKTFHEEVFRSHGLESNFKESFYSVSGKNVLRGM
HFQLPPHDHAKLVYVTSGEILDVAVDIREESSTFGKYFATKLSAKNAKSLYMDKGFAHGF
LTLSDFASVTYLTTSVHASEYDTGIHWNSFGFDWEGVEKPIVSERDKALEYLFEK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgataatcaccccaacccctatagatggcgtgttcgaaatagaaaataaagtatttgaa
gattttagagggaaatttgtgaaaacttttcatgaagaagtattcaggtcccacggcctt
gaatctaattttaaagaaagtttttattccgtatcaggtaagaatgttcttcgtgggatg
cactttcaacttccacctcatgatcatgctaaattagtttatgttaccagtggtgaaatc
ttggacgttgcggttgatattcgtgaagaatcatctacatttggaaaatatttcgcaaca
aaattatcagctaaaaatgcaaaatctttatatatggacaaggggtttgcacatggcttt
ttaaccttgtctgatttcgcttcggttacatatttgacaacttctgttcatgcttctgaa
tatgatactggaattcactggaatagctttggctttgattgggaaggcgttgaaaagccg
attgtttctgaaagagataaagcacttgaatatttatttgaaaaataa

DBGET integrated database retrieval system