KEGG   Hydrogenovibrio crunogenus: Tcr_1749Help
Entry
Tcr_1749          CDS       T00296                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00230  Purine metabolism
tcx00240  Pyrimidine metabolism
tcx01100  Metabolic pathways
tcx03030  DNA replication
tcx03430  Mismatch repair
tcx03440  Homologous recombination
Module
tcx_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tcr_1749
   00240 Pyrimidine metabolism
    Tcr_1749
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tcr_1749
   03430 Mismatch repair
    Tcr_1749
   03440 Homologous recombination
    Tcr_1749
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Tcr_1749
DNA replication proteins [BR:tcx03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Tcr_1749
DNA repair and recombination proteins [BR:tcx03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Tcr_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi BPS1
Motif
Other DBs
NCBI-ProteinID: ABB42341
JGI: Tcr1749
UniProt: Q31ET2
Position
1910163..1910603
Genome map
AA seq 146 aa AA seqDB search
MTATSSLEKDVIFYVLGTDTAQQREAFMAKLVNKIHREKRRCDIRFASEDEMTRFDLSLW
QYQPEAFIPHSVQQTVQAPIQLWADQIATPCQDVLLNVHPDFPQNFQLYNRTIEVLDQTE
HLIQMGRERWKAYKKEGLEPTVHKIK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaacatcgtcccttgaaaaggatgtcattttttacgtgttaggcacggatacg
gcccaacaacgggaagcctttatggccaaactggtaaacaaaatacaccgggaaaaacgc
cggtgcgatattcggtttgccagcgaggatgaaatgacacgctttgacttatcgctttgg
caataccaacccgaagcgttcatccctcacagtgtgcaacagactgttcaagcgcctatt
caactgtgggctgatcagatagcgaccccttgccaagacgttctgttgaatgtccaccct
gatttcccacaaaatttccaactttataaccgtaccattgaagtgttagaccaaacagaa
catttaattcaaatggggcgtgagcgctggaaagcttataaaaaagaagggttagaaccg
accgttcacaaaatcaaatag

DBGET integrated database retrieval system