KEGG   Thiomicrospira crunogena: Tcr_1937Help
Entry
Tcr_1937          CDS       T00296                                 

Definition
diguanylate cyclase
Organism
tcx  Thiomicrospira crunogena
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2123142..2125469)
Genome map
AA seq 775 aa AA seqDB search
MIFKRGLIGIVWLCMGWSIFLSNAAYADHPSKLNESALEKVTLQLKWHHQFQFAGYYAAQ
KEGYYQAEGLDVDIQPRDLHENNIQQVIDNKAQYGVADSILLLYQAKKAPLVIVAPIFQH
SPQVLFTLASSGIDSPYKLKNKKIALYQKDTDGFSVLAMLHEVGVSPTVERTIKSDASML
VQNQVDAYAGYLTNEAYTFHENNIPINVINPLNYGIDLYGDMLFTSQKEVSQHPERVEKM
RRATLKGWRYAMAHKTEMAHYIQSHYQMKKSFKHLMYEANAIENVMSLSTTPIGTLDEGR
LQFIANLFQKHGLIDNKVNLKSGVYRSGQKEIEFTAAEKKWLNEHPVVNLAIDRFYAPVE
FVNNQGQYAGIAKDIFQVIEQKTGIEFKPAMHLRWPEAVESMKQKKLDVFSAVIETEERK
DYVNFTMPYFKLPMAIATRESAPYIADSKQLSGKVICVVRDYASHAKLKRFYPNLPLLLV
DTPKEGIEAVANGKAYGYVDNVAVIGHHIKNSGLANVKISGEMPFRADIAIAVRDDWPEL
HSIIQKVLQQIPPETYAEISNKWLQVSYQKQYNWQQMTIVLAPILLLLGVFAFFNRKLRQ
TQKKLQETNKQLSILSVTDHLTGVYNRQYLDQRLDSEVERVNRYGSTFSVIMMDLDNFKK
VNDKFGHLVGDEVLVVFAQTVEKEIRKIDIFGRWGGEEFILICPETPLTHAIQLGKKVRK
SIESQDYPENISQTVSLGVAEYQTGEAINDCLNRADQNLYKAKQLGRNQVCPGLD
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaagcgcggattgattgggattgtatggctttgtatggggtggagcattttt
ttatcaaatgccgcttatgcagatcacccatccaaactcaatgaaagcgcgttggaaaaa
gtaacgctacaattaaagtggcatcatcaatttcaatttgctggctattacgctgcgcaa
aaagaaggctattatcaagccgaagggctggatgttgatattcaacctcgtgaccttcat
gaaaataacattcaacaagtaatcgacaacaaagctcaatacggcgttgccgattccatc
ttgttgttgtatcaagctaaaaaagcaccactggtcattgtagcgccgatatttcaacat
tctccccaagttttgtttacgttagcctcttcagggatagacagtccctataaacttaaa
aataaaaaaattgccttgtaccaaaaagataccgacgggttttccgtgttagctatgctg
cacgaagttggtgtttctccgaccgtcgaacgaaccattaaatcagatgcgagcatgttg
gttcaaaaccaagtggatgcctatgccggatatttgaccaatgaagcctatacattccat
gaaaataacattccgatcaatgtgattaatccgttgaactacggtattgatttgtatggc
gatatgctctttaccagtcaaaaggaagtttcccagcaccctgaacgggttgaaaaaatg
cgacgagcaacattgaaagggtggcgatatgccatggcgcataaaacggaaatggcgcat
tatattcagtcgcactatcaaatgaaaaaaagctttaagcatttaatgtatgaagctaat
gccattgaaaacgtgatgtcattaagtaccacgcctattggaacgctggatgaaggtcga
ttgcaattcattgcaaacctgtttcagaaacacggtttgatcgataacaaggttaatttg
aaaagtggggtttatcgttctggccaaaaggagattgaatttacagccgcagaaaaaaaa
tggttgaacgaacatcctgtggtgaatttagcgatcgatcgtttttacgcgcctgttgag
tttgtcaataatcaagggcagtatgcggggatagcgaaagatatttttcaggtgattgag
cagaaaaccggcattgagttcaagcctgccatgcatttgagatggcctgaagctgttgaa
tccatgaaacagaaaaaattggatgtgttttcagccgttattgaaacggaagaaagaaaa
gactacgtgaatttcacaatgccttatttcaaactgcctatggcgattgcgacacgtgaa
agcgcgccttatattgccgattcaaagcaattaagcggtaaggtgatttgtgtggtcagg
gattatgcctctcatgcaaaattaaaacgattttatccgaacctgcctttgttattggtg
gataccccaaaagaaggtatagaagcggttgccaatggaaaagcgtatggttatgtggat
aatgtcgcagtcattgggcatcacatcaaaaacagtgggttagctaatgtcaaaatatcg
ggtgaaatgccgtttagagcggacattgccattgcggttcgggatgattggcccgaacta
cacagtattattcaaaaggtattgcaacagattccaccggaaacctacgctgagatttcg
aataaatggttacaagtgagctaccaaaaacaatataactggcaacaaatgacaattgtt
ttagctcctattttgttgttacttggtgtgtttgcgttctttaaccgtaaactaagacag
acgcaaaagaaactacaagaaaccaacaagcagctttctattttatcggtgacggatcat
ttaaccggtgtgtataaccgtcagtatttagaccagcgtttggacagtgaggttgagcga
gtcaatcgctatgggtcaacctttagtgtcattatgatggatttggataattttaaaaaa
gtgaatgataaatttggtcatttagtgggcgatgaagtgctagtggtgtttgcgcaaacc
gttgagaaagagattcgtaaaatcgatatttttggtcgctgggggggagaagagtttatt
ttgatttgcccggaaacgcctttgacgcacgcgattcaattgggcaagaaagtaagaaaa
tccattgagagtcaggattatcctgaaaatatttcgcaaacagtgagtttaggtgtggct
gagtaccagacaggtgaagcgataaatgattgtttgaatcgagcagatcaaaatttatac
aaagccaagcaacttggtcgaaaccaagtttgtccgggccttgactaa

DBGET integrated database retrieval system