KEGG   Hydrogenovibrio crunogenus: Tcr_1989Help
Entry
Tcr_1989          CDS       T00296                                 

Definition
(GenBank) Pyridoxal-phosphate dependent enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcr_1989
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tcr_1989
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tcr_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2187493..2188695
Genome map
AA seq 400 aa AA seqDB search
MSYLKNFPNQEGYFGEFGGAFLPPELEPHFKEINQAYLTLGRSADFLNELKYIRKHYQGR
PTPVYYAHNLSREVGAHIYMKREDLNHSGAHKLNHCMAEALLAKHMGKTKLIAETGAGQH
GVALATAAAYFGMDCEIHMGEIDIAKEAPNVTRMKLLGANVVPVSFGGRSLKEAVDSAFQ
SYVPQADRALFAIGSVVGPHPFPMMVRNFQSVVGYESREQFLEMVGELPDQVGACVGGGS
NAMGMFAGFIEDESVTLNGVEPLGKGTKLGEHSATMTYGKPGMIHGFKCMLLSDDEGNPA
PVHSIASGLDYPGVGPEHSHLKMEGKVNYHGVTDQETLDAFYKLSSKEGIIPALESSHAV
AWAMKHGRENPGSTILINLSGRGDKDIDYVTENFGFGETL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcttaaaaactttcctaaccaagaagggtatttcggagaattcggtggtgcg
tttttaccccctgaattggaaccgcattttaaagagatcaaccaagcttatttaacgtta
ggacgctctgcagattttttaaatgaattaaagtatatccgtaaacattaccaaggccgc
ccgacgcctgtttattatgcgcacaatttaagcagagaagtcggtgcgcatatttacatg
aaacgcgaagatctgaatcattccggcgcgcacaaactaaatcactgcatggctgaagcg
ctgttggcgaagcacatgggaaaaaccaaactcattgccgagacaggtgcaggacaacac
ggagtcgccctagccaccgcagccgcttacttcggtatggattgtgaaatccatatggga
gaaattgacattgccaaagaagcgcccaacgtcacccgaatgaaattactcggggcaaat
gttgttccagtttcatttggcggacgcagcttaaaagaagcggttgattcggccttccaa
tcttatgtgccgcaagccgatagagcgttattcgcgattggttcagtggtcgggccacac
ccattcccaatgatggtgcgcaatttccaatcggttgtcggttatgagtcccgtgaacaa
tttttagaaatggtcggcgaactgcctgatcaggtcggtgcgtgtgttggcggtgggtcc
aatgccatgggcatgtttgccggcttcattgaagatgaaagtgtgacgttaaatggtgtc
gaaccgcttggaaaaggcaccaaacttggcgaacactctgcaaccatgacttatggtaag
ccggggatgattcacggctttaagtgtatgttactgtcggatgatgaaggaaacccagca
ccggttcactccatcgcctcaggtttagactacccaggtgtcggcccggaacactcacat
cttaaaatggaaggtaaagtgaactatcacggcgtgactgaccaggaaacattagatgcc
ttttacaagctgtccagcaaagaaggcatcatccctgcgcttgaaagctctcatgccgtt
gcatgggccatgaaacatgggcgtgaaaacccgggaagcaccattctgatcaatctgtct
ggacgaggcgataaagacatcgactacgtcactgaaaacttcggctttggtgaaaccctg
taa

DBGET integrated database retrieval system