KEGG   Thiomicrospira crunogena: Tcr_2030Help
Entry
Tcr_2030          CDS       T00296                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tcx  Thiomicrospira crunogena
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcr_2030
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcr_2030
   00650 Butanoate metabolism
    Tcr_2030
  Energy metabolism
   00190 Oxidative phosphorylation
    Tcr_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2241311..2241670)
Genome map
AA seq 119 aa AA seqDB search
MVIVGDLAMTYFLSGLRAHTWQRISAYYLLVYLPFSVLYLSDRSFDRYELFQAHLLQPEF
WVPTFIALGLLIVHSWVGLRDVLLDYLPRRFNVMGLVLLGGGLFWVSAELIYLALQLAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggttattgtgggagatttggctatgacgtattttttatccggtttgagagcgcacact
tggcaacgtatcagtgcctattacttgttggtgtatcttccgttcagtgtgttgtactta
agtgatcgatcttttgatcggtatgagttatttcaagcgcatttgttacagcctgaattt
tgggtgccgacgttcattgcgttaggtttgttgatcgttcacagttgggtcggtctgcgt
gatgttttgctggattatctgcctcgacgttttaatgtgatggggttagttttgctgggc
ggtggcttgttctgggtgagtgcagagttgatttacctcgccctgcaactggcgcgttaa

DBGET integrated database retrieval system