KEGG   Hydrogenovibrio crunogenus: Tcr_2030Help
Entry
Tcr_2030          CDS       T00296                                 

Definition
(GenBank) Succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00020  Citrate cycle (TCA cycle)
tcx00190  Oxidative phosphorylation
tcx00650  Butanoate metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
tcx01200  Carbon metabolism
Module
tcx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tcx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tcx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcr_2030
   00650 Butanoate metabolism
    Tcr_2030
  Energy metabolism
   00190 Oxidative phosphorylation
    Tcr_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Vwaint
Motif
Other DBs
NCBI-ProteinID: ABB42620
JGI: Tcr2030
UniProt: Q31E03
Position
complement(2241311..2241670)
Genome map
AA seq 119 aa AA seqDB search
MVIVGDLAMTYFLSGLRAHTWQRISAYYLLVYLPFSVLYLSDRSFDRYELFQAHLLQPEF
WVPTFIALGLLIVHSWVGLRDVLLDYLPRRFNVMGLVLLGGGLFWVSAELIYLALQLAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggttattgtgggagatttggctatgacgtattttttatccggtttgagagcgcacact
tggcaacgtatcagtgcctattacttgttggtgtatcttccgttcagtgtgttgtactta
agtgatcgatcttttgatcggtatgagttatttcaagcgcatttgttacagcctgaattt
tgggtgccgacgttcattgcgttaggtttgttgatcgttcacagttgggtcggtctgcgt
gatgttttgctggattatctgcctcgacgttttaatgtgatggggttagttttgctgggc
ggtggcttgttctgggtgagtgcagagttgatttacctcgccctgcaactggcgcgttaa

DBGET integrated database retrieval system