KEGG   Thioalkalimicrobium cyclicum: Thicy_0079Help
Entry
Thicy_0079        CDS       T01517                                 

Definition
aldose-1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tcy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
83082..83990
Genome map
AA seq 302 aa AA seqDB search
MLDQLQQRFDHPNVRFYQRDQLVMIELNNRYGQATVTTHGATLLSYIPAGGSDLLWVSDT
AIYDGSKPVRGGVPVCWPWFGAYDASKMGADPTDAVKKAHGFARYELWEVESVESIGDAT
QVVLSLTPNASIEKAWSHDFKLSLAITLGKQLTVELIGENRSDQAWYVTEALHTYFKVAQ
APGLVVEGLEGITYYDKNQDFAPFTQTDRLKVQAPMDCVYVDHIGAVVIKDQGRDIKMDK
SNSASTIVWNPGAEGVKAFADMPDGQYQHMVCIEAGNALQNGYELAAGARHVMTMTLEEV
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccaattacaacagcgttttgatcaccccaatgtgcgtttttatcagcgcgac
cagttggtaatgattgagctaaacaatcgttacggccaagccacagtgacgactcatggg
gcgaccctgctaagttacatccctgcaggtggcagcgatctattatgggtgagcgatacc
gcgatttatgacggcagtaagccagtgcgcggtggggtgccggtgtgttggccgtggttt
ggtgcttatgatgctagcaaaatgggcgcagacccaaccgatgccgtcaaaaaagcgcac
ggttttgcacgttatgaattgtgggaggttgaatcggtcgaatcaatcggtgatgctacc
caagtggtattaagcctaaccccaaatgcgtcgattgaaaaagcctggtcacacgatttt
aaactcagcctagccattaccctcgggaagcaattaacggtcgagctgattggcgaaaac
cgcagtgaccaggcctggtatgtcaccgaagccttgcacacctactttaaagttgcccaa
gcgccaggcctggtagttgaaggtttggaaggcatcacttattatgataaaaaccaagat
tttgctccctttactcaaaccgataggctaaaggtgcaagcaccgatggactgcgtctat
gtcgatcacatcggtgcagtcgtcatcaaagatcaagggcgtgatattaaaatggataag
agcaacagcgccagcaccatcgtttggaacccgggtgcggaaggtgttaaagcctttgcc
gatatgccagatggtcaatatcaacatatggtgtgtatcgaggcgggtaacgcgttacag
aatggttatgaattggccgctggcgctcgtcatgtcatgacaatgaccttggaggaggta
gcaagatga

DBGET integrated database retrieval system