KEGG   Thiomicrospira cyclica: Thicy_0103Help
Entry
Thicy_0103        CDS       T01517                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01130  Biosynthesis of antibiotics
tcy01230  Biosynthesis of amino acids
Module
tcy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thicy_0103
Enzymes [BR:tcy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thicy_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEG30879
JGI: Thicy_0103
UniProt: F6D948
Position
109694..110500
Genome map
AA seq 268 aa AA seqDB search
MATPTILNKINQRKLAEIAAAEAIVPLAEITALAEQTCLDNPVRGFAAALQVKVAAGQAA
VIAEIKKASPSKGVLRENFDPVAIAQAYERAGAACLSVLTDVDFFQGSADYLRQARAAVS
LPVIRKDFIIAPYQVYEARAMGADCILLIAASLTNAQMVELTALAQTLQMDVLIEVHDGE
ELDRALSIPLPLIGINNRNLHNFEVSLQTTLDLLARLPADRLVITESGILSAADVQLMRS
HDVHGFLVGEAFMRAHDPGDALADMFKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcaactccaactatcttaaataaaattaatcaacgcaagctcgcggaaattgccgcg
gcagaagctattgtacctttggctgaaatcaccgcactggccgagcagacctgcttggat
aatcccgtgcgcggttttgctgccgcactacaagtcaaagttgcggccggtcaagcggcg
gtgattgccgagattaaaaaagcctcgcccagtaagggcgtgttgcgtgaaaactttgat
ccagtggcgattgctcaagcctatgagcgagcgggtgcggcttgtttgtccgtgttaacc
gatgttgatttttttcagggctcggcagactatttgcgacaagcacgggcggcggtcagt
ttgccggtaattcgcaaagattttattattgcgccctatcaagtctatgaagcgcgggcg
atgggtgcggattgtattttgttaatcgccgcttctttaaccaatgcgcaaatggttgag
ttaaccgcgcttgcccaaacgttacagatggatgtgttaatagaagtgcatgatggtgaa
gagctcgatcgtgctttgagcattccgttgccgctgatcgggattaataaccgcaatttg
cataattttgaggtgagtttgcaaaccactttggatttgttggcgcgtttaccggctgac
cgattagtgattaccgaaagtggtatcttgtcggccgccgatgttcagctgatgcgtagc
catgatgtgcatggctttttggtcggtgaggcctttatgcgcgcccacgatccgggtgat
gccttagccgatatgtttaagctgtga

DBGET integrated database retrieval system