KEGG   Thioalkalimicrobium cyclicum: Thicy_0169Help
Entry
Thicy_0169        CDS       T01517                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_0169
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thicy_0169
Enzymes [BR:tcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thicy_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
164789..165910
Genome map
AA seq 373 aa AA seqDB search
MDRLALSQTRRWVIKLGSALLTNDGSGLNQTELAKWVAQMVLLRNQGVELIIVSSGAVAE
GMQRLGWKTRPTALNELQAAAAVGQMGLVQAYESEFAKSGLHTAQILMTHDDLSNRARYL
NARSTIQTLVEHGVIPVINENDTVVTDEIRFGDNDTLAALTANLIGADVLVILTDQQGLY
DSNPRENPQAQLIKQAQVSRKDIEAMASPLGGALGRGGMYTKVMAAKRAARSGTATLIAS
GREADILPKLFAGEDYGTLLVPDLEPMTARKQWLAGHLQVRGQLTLDDGAAKVVRAHGKS
VLPVGVVALSGQFKRGDMVVCVDQQQHEVARGLVNYDWDEAQRILRQPSTKIAEILGYVD
DESLIHRDNLVVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtttggccctatctcaaacgcgacgctgggttattaaacttggtagcgcactc
ttaaccaatgacggttcaggtctcaaccaaacagagttggcgaaatgggttgctcaaatg
gtgctgttgcgtaatcagggtgttgagctaattattgtatcctctggtgcagtggccgaa
gggatgcagcgtttaggttggaaaacgcgaccaacggcattgaacgagttgcaggccgct
gcggctgtgggtcagatgggtttagttcaagcctatgaatccgagtttgcgaaaagtggc
ttacacaccgcgcaaattttaatgacccatgatgatctatccaatcgcgcgcgttattta
aatgctcgttctactattcaaaccttggttgagcatggggtaattccggtcatcaatgaa
aatgataccgtggtaaccgatgaaattcgctttggtgataatgataccctggctgcttta
acggccaacttaattggcgccgatgttttagtgattttgaccgatcaacagggattgtat
gacagtaatccgcgtgaaaaccctcaggctcagttaattaaacaggcccaagtcagtcgc
aaggatatcgaggcgatggcaagccctcttggtggtgcattagggcgtggcggcatgtat
accaaggtgatggccgcgaaacgtgcggcacgctcaggtacggcaaccttaattgcttcg
ggtcgagaagcggatattctgccaaaactttttgcgggtgaagattacggcactttgctg
gtacccgacttagagccgatgaccgcacgtaaacagtggttggccggacatttacaggtt
cgtggtcaactgactcttgatgatggggcggccaaggttgtgcgtgcgcatggtaaaagc
gttttaccggttggcgtcgtcgctttgtcaggtcagtttaagcggggcgatatggtggtg
tgtgtggatcagcagcagcacgaggtcgcccgaggactggttaattatgattgggatgaa
gctcagcgaattttacgccaacccagtaccaaaattgccgaaattcttggttatgtcgat
gatgaatctttgattcatcgtgataatcttgtggtgttgtaa

DBGET integrated database retrieval system