KEGG   Thioalkalimicrobium cyclicum: Thicy_0210Help
Entry
Thicy_0210        CDS       T01517                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thicy_0210
Enzymes [BR:tcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Thicy_0210
Peptidases [BR:tcy01002]
 Cysteine Peptidases
  Family C44
   Thicy_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
206328..208136
Genome map
AA seq 602 aa AA seqDB search
MCGICGEFLWRDGQQADPMRINKMLTQLVKRGPDAKDFWVQEQVGFGHTRLAIIDLTPAG
QQPMRDQELTLVFNGCIYNYKALRAELIILGHEFQSDSDTEVILKAYRQWGSECLNYLDG
MFAFAIWDDHQQQLFLARDRFGIKPLYYALTDEGLRFASNTQALLASGGINLDIDPIGLH
FQLTLHGVIPAPHTILKGIKKLQPGHYMLVQPDGQIFVRQYWQLNAQRPDASDLSQPQTE
QAWLDATHDALKKAVAKRVAAADVPVGVLLSGGLDSSLLVGLLAEAGMDRIQTFSIGFED
IADEQGSEFEFSDKVVARYNTQHHKYVVPNSDVLPRLPEAVAAMSEPMVGQDAVAFYLLS
EQVSQDVKVVLSGQGADEVFGGYFWYPQMAASTGSTIARFAPYYFDRSHEEWLQTVDARF
HLDDVTSAYVSERLTEPGADEFLDQVLRFDATTLIVDDPVKRVDNMTMAWGLEARVPFLD
KDLVELAMQAPPELKLGDDGKTLLKRIARGLVPDEVIDRPKGYFPMPALKFVRGEFYQFM
RDILMSPAAQARGLFNPDYVARLLANPEASENFTAIKGSKLWHCALLELWLQTHVDPYRS
AD
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttgcggtgagtttttgtggcgagacgggcaacaggctgatcctatgcgc
attaataaaatgttgacgcagttagttaagcgtggtcccgatgcaaaggacttttgggtt
caagagcaggtgggatttggtcatacccgcctagccattattgatttaacgccagcaggt
cagcaacccatgcgagatcaagaactcactttggtctttaatggctgtatttataactat
aaagctttgcgagctgagctgattattttagggcatgaatttcagtcggattctgatacc
gaggttattctaaaagcctatcgccaatggggttctgaatgtttgaactatttggatggt
atgtttgcatttgccatttgggatgatcatcaacaacagttgtttttagcgcgcgatcgc
tttgggattaaaccgttatattatgcgttgacggacgaaggtttgcggtttgcctctaat
acgcaagcgctattagcgtctggcggtataaatttggatattgacccaataggtctgcat
tttcagttaaccctacatggtgtgattcctgcaccccataccattctaaaagggattaaa
aaactacagcctgggcattacatgctggtgcagccagacggacaaatctttgtgcgccaa
tattggcagctcaatgcgcagcgtcctgatgcctcggacctgagtcagccccaaactgag
caggcctggttagacgcaacgcacgacgcgcttaaaaaagcggtggctaagcgggtcgca
gcggctgatgtgccagtaggtgttttgctgtcaggcgggctggattcgagtttgttggta
ggcttattggccgaagcaggtatggataggattcagaccttttcgataggctttgaagat
atcgccgatgagcagggctcagagtttgaattttccgataaggtcgtggcacgttataac
actcagcatcataaatatgttgtgccgaatagtgatgtgttgcctcgtttgccagaggcg
gttgctgccatgtccgaacctatggtcggtcaagacgcggtggctttttatctgttatca
gaacaggtgtctcaagatgtgaaagtggtgctatcgggtcaaggtgcggatgaagtattt
ggaggctatttttggtatccacagatggccgcatcaaccgggtcaaccattgcacgtttt
gcgccttattattttgaccgcagtcatgaggaatggttgcaaacggttgatgcccgcttt
catctcgatgatgtgaccagtgcttatgtctctgaacgtttaacggagccaggagcagat
gagtttttagatcaagtacttcgtttcgatgcgaccaccttaattgtcgatgaccctgta
aaacgggtcgataatatgaccatggcttggggtttagaagctcgtgtaccttttttagat
aaggatttggtggagctggcgatgcaggctccgcctgaacttaaattaggcgatgatggg
aagaccctcttaaagcggatcgcgcgtggtctggtgcctgatgaggtgattgatcgtccg
aaaggttatttccccatgcctgcactgaagtttgttcgtggtgagttttatcaatttatg
cgtgatattttaatgagccctgcggcgcaagcgcggggtttatttaatccagattatgtt
gctcgattgttggcgaatccggaagcctcagaaaactttactgcgattaagggctctaaa
ttatggcactgcgcactattagaattatggttgcaaacccatgttgacccatatcgatcg
gcagactaa

DBGET integrated database retrieval system