KEGG   Thioalkalimicrobium cyclicum: Thicy_0293Help
Entry
Thicy_0293        CDS       T01517                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thicy_0293
   00670 One carbon pool by folate
    Thicy_0293
Enzymes [BR:tcy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Thicy_0293
    1.5.1.-  
     Thicy_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
381817..382548
Genome map
AA seq 243 aa AA seqDB search
MKLEQAIVITGAGQRIGLALAQHLLAQGDYPLVFTYRTRKPGVEALLDAGAVGFQVDFNQ
ADAVASLMSRLTEQVGSMRALIHNASLWWPDSEPNALQKQFDVHVRAPYELNQACLPLLQ
ACDGPNKDIISISDARVVQGHPAKIAYMATKAALENMTLSFAQAFAPAVKVNAIAPALLT
FHPQDSAEYRQARFDRLLLPMEPGAEVLCQAVDYLLDSPYTTGTIMSLDGGSRLVGQRLD
SNK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcgaacaggcaattgtgattacgggcgcaggtcaacggattgggctggctctg
gcgcagcatctgttagcacaaggcgattaccctctggtctttacctatcgtacccgtaaa
cccggcgtagaggctttgctggatgcgggtgcggtcggttttcaggtcgattttaaccaa
gccgatgcggtagcgagcttaatgtcgcgtttaacggagcaggtgggcagtatgcgtgcg
ctgattcataatgcgtcgctctggtggccggattccgagccgaatgcgctgcaaaaacag
tttgatgtgcacgtgcgggcgccctatgagttgaaccaggcctgcttgccgttgttacaa
gcctgtgacgggccgaacaaagacattatcagtatttcagatgcgcgcgttgtgcaaggg
catccggcgaaaattgcctatatggccaccaaagcagcactagaaaacatgaccctgtcg
tttgcgcaggcctttgcgccagcggtcaaagtcaatgcgattgccccagcattgttaacc
tttcatccgcaagatagtgccgagtatcgtcaagcccgttttgatcgcttattgttgcct
atggagccgggcgccgaggtattgtgccaagcagtggattatttgttggacagcccctac
accaccggcacgattatgtccttagatggcggtagccgcttggttggccagcgcctagat
agtaataagtag

DBGET integrated database retrieval system