KEGG   Thiomicrospira cyclica: Thicy_0320Help
Entry
Thicy_0320        CDS       T01517                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00240  Pyrimidine metabolism
tcy00250  Alanine, aspartate and glutamate metabolism
tcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thicy_0320
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thicy_0320
Enzymes [BR:tcy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Thicy_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEG31096
JGI: Thicy_0320
UniProt: F6DAD0
Position
complement(407052..408092)
Genome map
AA seq 346 aa AA seqDB search
MSPRLNAPNLQLNELGKLKHFLSLDGLKQQHLNEILDLAESFINPQTNEIKKVPLLRGKT
IMNLFFEPSTRTRTTFEIAEKRLSADVMNLNISASATKKGESLLDTLWNLEAMQADMFVV
RHAESGAAHFFAEHVAPHVHVLNAGDGQHAHPTQAMLDMFTIRKLKGDIFDLKVAIVGDI
LHSRVARSQIQALSLLEAREIRVIGPKTLIPPYPESLGVQVYHDMKQGLDDVDVVIMLRL
QNERMQSALLPSADEYFKTYGLTEERLSYAKPNAIVMHPGPINRGVEIDSAVSDGSQSVI
LQQVTYGIAVRMAVMAIIMSNAAQLQQLKHEQAQQIDDPTSTEVNS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcccacgtcttaatgctcccaatttgcagctcaatgaactgggaaagctcaaacac
tttctgagtctggatggtttaaaacagcagcacctaaatgaaatcctcgatttggcggaa
tcctttattaacccgcagactaacgaaatcaagaaggtcccgctattgcgcggcaaaacg
atcatgaatctgttctttgaaccgagcacacggacgcgcactacctttgaaatcgccgaa
aaacgcctgtcagcagatgtcatgaacctcaatatcagtgcttcagccaccaaaaaaggc
gaatcactgctcgataccctgtggaatctcgaggccatgcaagccgatatgttcgtagta
cgccatgctgagagcggggccgctcacttttttgccgagcatgtcgctcctcatgtacac
gtacttaatgccggagatggtcaacacgcgcaccccactcaagcgatgctagatatgttt
acaattcgcaaactcaaaggcgatatttttgatctcaaggtggcgattgtgggcgatatt
ttgcactcccgagtcgcacgttcacaaatccaagcccttagtttattggaagctcgtgaa
attcgcgttatcggccctaaaacactgattccgccctatcctgaaagcctgggggttcag
gtttatcacgatatgaaacaaggcttagacgatgttgatgtggtgattatgctgcgcttg
caaaatgaacggatgcaaagcgccttactacctagtgccgatgagtattttaaaacttat
ggtttaaccgaagaacgtcttagctatgccaaaccaaatgccattgtgatgcatccgggt
ccgattaatcgtggcgtcgaaattgactcggcggtctccgatggttcccagtcggtgata
ttacaacaagtcacctacggcattgccgtgcgcatggcggtgatggcgattattatgagc
aacgccgcgcaactgcaacagcttaaacacgaacaagcgcaacagattgatgacccaacc
agcacggaggtcaactcatga

DBGET integrated database retrieval system