KEGG   Thioalkalimicrobium cyclicum: Thicy_0623Help
Entry
Thicy_0623        CDS       T01517                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_0623
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thicy_0623
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thicy_0623
Enzymes [BR:tcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thicy_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
767248..768471
Genome map
AA seq 407 aa AA seqDB search
MSKSSEQQIDFSQYPDSQGHFGPYGGIFAPETLMAPLEALRDQYAAVKDDPVFRAELLND
YQNYIGRPTPLYHAKRWSEHLGGAQIYLKREDLNHTGAHKINNTIGQALLAKRLGKTRII
AETGAGQHGVASATVAARLGLECVVYMGADDVVRQAPNVARMKMLGATVVPVESGTRTLK
DALNEAMRDWVTNVDDTFYIIGTVAGPHPYPMMVRDFQAIIGQEARQQMLDQEGVLPDIV
MACVGGGSNAMGLFHAFLPDESVRIIGVEAGGDGLETGRHAAPLCKGTPGVLHGNRTYLM
QDEAGQIMGTHSISAGLDYPGVGPELAWLKDIGRAEFFAVTDDEAMAGWRDVTRMEGIIS
ALETSHALAYAIKLAPTLPKTQRIIINLSGRGDKDMNTIAKVEGFEF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagtcgtcagaacaacaaattgatttttcacaatatcctgacagtcaaggccat
tttggtccctatggtgggatttttgcaccggaaacattaatggcgccattggaagccttg
cgcgatcagtatgccgctgttaaagatgatccggtgtttagagccgagctcttaaatgat
tatcaaaactatattggtagaccaacgccgctatatcatgcgaaacgttggtctgagcac
ctaggcggtgcgcaaatctaccttaaacgagaagaccttaatcataccggcgcccacaag
attaataacaccattggtcaagctttacttgcgaaacgtttgggaaaaacgcgaatcatt
gcggaaacaggcgccggtcagcatggtgttgcgagtgcgacagttgctgcacgccttggc
ttggagtgtgttgtctacatgggtgctgacgatgttgttcgtcaagctccaaacgtagcg
cgcatgaaaatgttgggtgcgacggtggtgccagtagagtcaggcactagaactttaaaa
gatgcacttaacgaagccatgcgtgactgggtgactaatgttgatgataccttctatatt
attgggaccgtggcgggtcctcatccctatccaatgatggttcgagattttcaggcaatt
attggtcaagaagcccgtcagcaaatgttagatcaagagggcgtattgcctgatattgtc
atggcctgtgtcggcggtggttccaatgcgatgggcttgtttcatgcgtttttacccgat
gaatcagtgcggattattggtgttgaggcgggtggtgacggtttagaaactgggcgtcac
gcggctccactttgcaagggtacccctggcgttcttcatggtaatcgcacttatttaatg
caagatgaagcaggtcaaattatgggcacccactcgatttcagctggtctggattatcct
ggcgtgggtccagagctggcctggttaaaagatattgggcgcgctgagttttttgcagta
actgacgacgaagccatggcggggtggcgcgatgtgacccgaatggagggtattatttcg
gcactcgaaacaagtcacgctttagcctatgcaatcaagcttgcgcctaccttacctaaa
acacagcgtattattattaatttatctggccggggtgataaggatatgaacactatcgct
aaggttgaaggttttgaattttaa

DBGET integrated database retrieval system