KEGG   Thioalkalimicrobium cyclicum: Thicy_0624Help
Entry
Thicy_0624        CDS       T01517                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_0624
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thicy_0624
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thicy_0624
Enzymes [BR:tcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thicy_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
768482..769309
Genome map
AA seq 275 aa AA seqDB search
MNRIEARFASLQAQQKTALIPYLTAGDPHPDMTVDLMHYLVEQGADLLELGVPFSDPLAD
GPTIQKAVERALAHRVTLRDVLAMVAKFREQDNNTPVILMGYLNPVEAMGEAEFATSAVK
AGLDGILTVDMPPEESVGYHDTMASQGLSCIFLVSPTTPASRLGAIAEQGKGFVYYVSLK
GVTGVGQADVGDVETHVKALKEVINLPVGIGFGVRDGQAAYKMAQHGAGVIIGSALVSII
EQNQTAGLVQIKAVLTPKMVEFRQAIDAADRGDVL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgaattgaagcacgctttgcgtctctgcaagcacagcaaaaaaccgcgcttatt
ccctatttaacagcgggtgatccgcatcccgatatgacggtcgatttaatgcactatttg
gttgaacagggtgctgatctattggaattgggtgtgcctttttctgatccgcttgccgat
ggtcctactattcaaaaagccgtcgaacgtgcattagcgcatcgggtgaccttgcgtgat
gtgctagcgatggtggctaagtttcgtgagcaggataataataccccagtgattttaatg
ggctacctaaaccctgtcgaggcgatgggtgaggcagagtttgcaacttctgcggtaaag
gctggattagacggtattttgacggtagatatgccacccgaagaaagtgtcggttatcat
gacactatggcaagtcagggtttatcttgtattttcttagtgtcgccgacaactccggct
tcgagactaggtgcgattgcagagcagggtaaaggttttgtttattatgtgtcattgaaa
ggtgtgactggcgttgggcaggcagatgttggcgatgtggagactcatgtgaaggcgctt
aaagaagttattaacttgccagtgggtattgggtttggcgttcgtgacggtcaagcggct
tacaagatggctcagcatggcgctggggtcattattggttccgcattggtaagtattatt
gagcaaaatcagactgccggcctggtccagataaaagcggtgttaacgccaaaaatggtt
gagttccgccaggcgattgatgccgcagacagaggggatgtgctatga

DBGET integrated database retrieval system