KEGG   Thioalkalimicrobium cyclicum: Thicy_0635Help
Entry
Thicy_0635        CDS       T01517                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thicy_0635
   01230 Biosynthesis of amino acids
    Thicy_0635
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0635
   00051 Fructose and mannose metabolism
    Thicy_0635
   00562 Inositol phosphate metabolism
    Thicy_0635
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thicy_0635
Enzymes [BR:tcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thicy_0635
Exosome [BR:tcy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thicy_0635
  Exosomal proteins of bladder cancer cells
   Thicy_0635
  Exosomal proteins of melanoma cells
   Thicy_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
780252..781022
Genome map
AA seq 256 aa AA seqDB search
MRIPFVAGNWKMHGSKAMIQDHLGQFTQQAEALNNVNIAVCPPSLYVSAVQSQLTSSSVK
VGVQNVCDQAGFGAYTGEVSVDMLVDMGVPYAIVGHSERRAFYCETDRQVADKVAIVLDK
NLTPILCIGETLEERESDQTEHVVKTQLIAVIEKVGIAAFANIVIAYEPIWAIGTGKTAS
PEQAQAVHAFIRNLLAQHDTAVAQQVVIQYGGSVKPDNAAALFAQPDIDGGLIGGASLDP
MDFLAICKAASQSCLK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcccatttgttgcaggaaattggaagatgcatggctccaaagctatgattcaa
gaccacttggggcagtttacacagcaagctgaggcgttgaataatgtaaatatagcggtt
tgtcccccaagtctatatgtaagtgctgtacaatcacagctcacttcaagtagtgtaaaa
gttggtgtgcaaaatgtatgcgatcaagcaggttttggcgcctacactggtgaagtgtct
gttgatatgcttgttgatatgggtgtgccctatgcgattgttggtcactcagaacgtcgt
gcgttttattgcgaaaccgatcgtcaggtagccgacaaggttgcgattgtgctcgataaa
aacctaacacctattttatgtattggtgaaactctagaagagcgcgaaagcgaccaaaca
gaacatgtggttaaaacacagcttatagctgttattgaaaaggttggtattgcagcattt
gctaatattgtaattgcctatgagcctatttgggcgattggtaccggtaagacagcaagc
cctgagcaagcccaagcggtacatgcgtttatacgtaaccttcttgcacaacatgataca
gcagttgcacagcaggtagtgattcagtatggcggtagtgtaaaaccggataatgccgct
gctttgtttgctcaacccgatattgatggtgggttaattggcggtgcgtcacttgatccg
atggattttttagcaatttgtaaggcggcttcgcaatcatgtttgaaatag

DBGET integrated database retrieval system