KEGG   Thiomicrospira cyclica: Thicy_0700Help
Entry
Thicy_0700        CDS       T01517                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy00020  Citrate cycle (TCA cycle)
tcy00620  Pyruvate metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Module
tcy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0700
   00020 Citrate cycle (TCA cycle)
    Thicy_0700
   00620 Pyruvate metabolism
    Thicy_0700
Enzymes [BR:tcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Thicy_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AEG31472
JGI: Thicy_0700
UniProt: F6DC86
Position
848638..849984
Genome map
AA seq 448 aa AA seqDB search
MAKIQLLVPDIGDFDSVDVIEVLINDGDQIQLDDSVLTLESDKATMEVPATYAGKVSNLQ
VKVGDKVAKGSYICDLEVSDAAVAAPNDASTEQQTPTVAEIAAAPAAVEQAPTKLHEQTH
ASNVGLPIARSVSNTPKPVNHQSSGAVFHATPTVRAFARVLGVELTQVSGSGSKGRILKT
DIEAFVKSVMQAGGAQATSGTVGSGIPVLPTIDFTQFGEVEEVELSRIKKISGKHLSTAW
LNIPHVTQFDECDITSLEEFRKDMKAQAEKAGVKLTPLVFIMKAVVAGLKSFPNFNASLS
PDGQKLLRKGYFNIGIAVDTPNGLVVPVVRDVDQKSIFELSRELMELSAKARDGKLSPKD
LSGGCFSISSLGGIGGTQFTPIVNAPEVAIMGVSKAKIQPVWDGSSFQPRLIMPFSVSYD
HRVIDGAEGVRFTQFIGQHLADIRQLLL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatacagttattagtacctgacatcggcgattttgacagcgttgatgttatt
gaagtgttaattaatgacggtgaccagattcaactggatgattcagtgctgacgctggaa
tcggataaggcgacaatggaagtgcctgcaacctacgccggtaaagtctctaatctgcaa
gtgaaggttggcgataaggtggctaaggggtcttatatttgcgaccttgaggtttctgat
gcggccgttgcagcgccgaatgatgcttcaactgagcagcaaacgccaacggttgcggaa
attgcggcggcgccagctgctgtggaacaagcaccgaccaagctgcatgaacaaactcat
gcatcgaacgtcggcctgccgattgctcgctcggtgtccaatacaccaaagcccgttaac
catcaatcgagtggtgcggtgtttcatgccaccccgacagtgcgggcttttgcccgggtg
ctgggtgttgagttaactcaagtatcgggaagcggtagtaaaggtcgtattttaaagacg
gatattgaggcctttgtgaagtcggttatgcaagctggtggtgctcaggcgacctcaggt
actgtgggtagtggtattccagtactcccaacgattgactttacccagtttggcgaggta
gaagaagttgagctaagtcggattaaaaagatttccggcaaacacctctccacggcctgg
ttaaatattccgcatgttactcaatttgatgagtgtgacattacttcgctagaagaattc
cgcaaggatatgaaggcgcaagctgaaaaagccggtgttaagttgacaccactggtgttt
attatgaaagcggtcgttgccggattaaagtcgtttccgaacttcaatgcgtcgctgtcg
ccagacgggcaaaaactgcttcgcaagggctattttaatattggaattgcggtcgataca
ccaaatggtttagttgttccggtggttcgcgatgttgatcaaaaatcgatttttgaatta
tcgcgtgaattaatggaactcagtgccaaggcgcgtgatggcaaattatcacccaaagac
ttatccggtggctgtttcagtatttctagtttgggcggtattggtggcacgcagtttacc
ccaatagtgaatgccccagaagtggccattatgggggtttctaaggcgaaaatacagcca
gtatgggatggtagtagtttccagccccgcctaataatgccgtttagtgtctcctatgat
caccgggttattgatggcgcggaaggtgtgcgctttactcagtttattggtcaacatttg
gcggacattcgccaattattactgtaa

DBGET integrated database retrieval system