KEGG   Thioalkalimicrobium cyclicum: Thicy_0721Help
Entry
Thicy_0721        CDS       T01517                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_0721
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thicy_0721
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thicy_0721
Enzymes [BR:tcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thicy_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
869369..870847
Genome map
AA seq 492 aa AA seqDB search
MNFIETRGNDGHFPPQFTFSQAILSPMSSYGGLYSPKSLPRLDQAFLAAHLDSDYKKLAK
AILMKFEVDIPEVVIDRALALYDQFDDPKHPVPVVKVTDRIFVSELFHGPTRAFKDMALQ
PFGTLLSAVAQARDEQFLILAATSGDTGPAALDTFRDKPNVQVVCMYPEGGTSDVQRLQM
VTEAGKNLKVIGIKGDFDDAQSALKTLLTSPEFKATLQQKGIAVSAANSVNFGRIIFQTL
YHVHSYLELVRMGEISLGEKVYLNVPSGNFGNALGGYYAYKMGLPVEKILIASNDNNVLT
QFINKGVYDLRNAQVQPTKSPAMDILKSSNIERILFDMLGADRTRELMLALDKDKYYQLT
ADELKQVQAIFAADHCTDAEGAHYIKQRFEQGYLMDPHTATSFKVDATQATNSAIKSIIY
STAEWTKFSPTIVASIFDKAVSNDEEALQVMSDTGKACIPKQIAALFTKPQVQDNVIEKT
AIEAEILRFFEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattgaaacccgtggtaatgacggacacttccccccgcaatttactttttcg
caagcgattttgagccctatgtcgtcttatggtggtttatattcaccaaagtcgttgcct
agattagatcaagcgttcttagcagcccatttagattctgattacaaaaagctggctaaa
gccatcctaatgaagtttgaagtcgatatccctgaagtggtcattgatcgcgccttagca
ctttatgatcagtttgatgatccaaagcatcccgtgccggtggtgaaggttactgatcgt
atttttgtcagtgagttatttcatggtccaacgcgtgcttttaaggacatggctttacag
ccgtttggaaccttattatcggctgtcgcacaagcccgagacgaacagtttttaattttg
gcagcaaccagcggcgataccgggccagctgccttagatactttccgtgataagccaaat
gtgcaggtagtgtgtatgtatcctgaaggcggcacatccgatgtacagcgcttacaaatg
gtcaccgaggcgggtaaaaatctcaaagttattggcattaaaggcgattttgatgatgcc
cagtcggcattgaaaaccctattaacatcgcctgaatttaaggcaactttgcagcaaaag
ggcattgcggtatcagcggctaattcggtgaactttgggaggattatttttcagacactc
tatcatgttcatagctacttggaactggtcagaatgggtgagatttcgctgggcgagaag
gtttatttgaatgtacccagtggcaattttggtaatgcgttgggcggctattacgcctat
aaaatgggtttgccggtcgagaagattttaatcgcttcaaatgataataatgtgttgacg
cagtttataaacaaaggggtttatgatttgcgtaatgctcaggtgcaaccgaccaaatca
ccagcgatggatattttaaaatcatcgaatattgagcgtattttgtttgatatgttgggt
gctgatcgtacacgtgagttaatgttggcgctcgataaggacaaatattatcagctgaca
gccgatgagcttaagcaggtgcaagcgatttttgcggcagaccattgtaccgatgccgaa
ggtgcgcactatattaagcagcgctttgagcagggttatttaatggatccgcacacggcg
acgagctttaaagtggatgcgacacaagcaacaaattcagccattaaatcgattatttac
tcaaccgcagaatggacgaagttttctccaactattgtggccagtatttttgataaagcc
gtatccaatgatgaagaagctttacaagttatgtctgatacaggtaaagcctgcatccct
aaacagattgcagcgctgtttaccaagccacaggtacaggataatgtcattgaaaaaacg
gcaattgaagcggaaattttgcgcttttttgaagcctag

DBGET integrated database retrieval system