KEGG   Thioalkalimicrobium cyclicum: Thicy_0721Help
Entry
Thicy_0721        CDS       T01517                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_0721
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thicy_0721
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thicy_0721
Enzymes [BR:tcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thicy_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
869369..870847
Genome map
AA seq 492 aa AA seqDB search
MNFIETRGNDGHFPPQFTFSQAILSPMSSYGGLYSPKSLPRLDQAFLAAHLDSDYKKLAK
AILMKFEVDIPEVVIDRALALYDQFDDPKHPVPVVKVTDRIFVSELFHGPTRAFKDMALQ
PFGTLLSAVAQARDEQFLILAATSGDTGPAALDTFRDKPNVQVVCMYPEGGTSDVQRLQM
VTEAGKNLKVIGIKGDFDDAQSALKTLLTSPEFKATLQQKGIAVSAANSVNFGRIIFQTL
YHVHSYLELVRMGEISLGEKVYLNVPSGNFGNALGGYYAYKMGLPVEKILIASNDNNVLT
QFINKGVYDLRNAQVQPTKSPAMDILKSSNIERILFDMLGADRTRELMLALDKDKYYQLT
ADELKQVQAIFAADHCTDAEGAHYIKQRFEQGYLMDPHTATSFKVDATQATNSAIKSIIY
STAEWTKFSPTIVASIFDKAVSNDEEALQVMSDTGKACIPKQIAALFTKPQVQDNVIEKT
AIEAEILRFFEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattgaaacccgtggtaatgacggacacttccccccgcaatttactttttcg
caagcgattttgagccctatgtcgtcttatggtggtttatattcaccaaagtcgttgcct
agattagatcaagcgttcttagcagcccatttagattctgattacaaaaagctggctaaa
gccatcctaatgaagtttgaagtcgatatccctgaagtggtcattgatcgcgccttagca
ctttatgatcagtttgatgatccaaagcatcccgtgccggtggtgaaggttactgatcgt
atttttgtcagtgagttatttcatggtccaacgcgtgcttttaaggacatggctttacag
ccgtttggaaccttattatcggctgtcgcacaagcccgagacgaacagtttttaattttg
gcagcaaccagcggcgataccgggccagctgccttagatactttccgtgataagccaaat
gtgcaggtagtgtgtatgtatcctgaaggcggcacatccgatgtacagcgcttacaaatg
gtcaccgaggcgggtaaaaatctcaaagttattggcattaaaggcgattttgatgatgcc
cagtcggcattgaaaaccctattaacatcgcctgaatttaaggcaactttgcagcaaaag
ggcattgcggtatcagcggctaattcggtgaactttgggaggattatttttcagacactc
tatcatgttcatagctacttggaactggtcagaatgggtgagatttcgctgggcgagaag
gtttatttgaatgtacccagtggcaattttggtaatgcgttgggcggctattacgcctat
aaaatgggtttgccggtcgagaagattttaatcgcttcaaatgataataatgtgttgacg
cagtttataaacaaaggggtttatgatttgcgtaatgctcaggtgcaaccgaccaaatca
ccagcgatggatattttaaaatcatcgaatattgagcgtattttgtttgatatgttgggt
gctgatcgtacacgtgagttaatgttggcgctcgataaggacaaatattatcagctgaca
gccgatgagcttaagcaggtgcaagcgatttttgcggcagaccattgtaccgatgccgaa
ggtgcgcactatattaagcagcgctttgagcagggttatttaatggatccgcacacggcg
acgagctttaaagtggatgcgacacaagcaacaaattcagccattaaatcgattatttac
tcaaccgcagaatggacgaagttttctccaactattgtggccagtatttttgataaagcc
gtatccaatgatgaagaagctttacaagttatgtctgatacaggtaaagcctgcatccct
aaacagattgcagcgctgtttaccaagccacaggtacaggataatgtcattgaaaaaacg
gcaattgaagcggaaattttgcgcttttttgaagcctag

DBGET integrated database retrieval system