KEGG   Thioalkalimicrobium cyclicum: Thicy_0755Help
Entry
Thicy_0755        CDS       T01517                                 

Definition
6-phosphogluconolactonase (EC:3.1.1.31)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:tcy01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tcy00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
905506..906210
Genome map
AA seq 234 aa AA seqDB search
MTSPAEVVYPKEWRIFKNSELLAQQAVADIVTTSEIAIKARGAFHLVTAGGRTPNRIYQL
LAQTEQDWSRWHIYTGDERVAPLGDTQRNATALFSHWLNEVSIPEANLHLMQTHWPVAEA
LADYQQQVAGLVFDMTLLGMGEDGHTASLFPNQAWRILAGDVALVIDSPKPPPVRLTLTL
ACLNRSRQIIKLITGAEKNPAILEWLAGDELPIVAPLGSEVTKVYLDESACLGA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcccgctgaggttgtttaccccaaagaatggcgtatttttaaaaacagcgag
ttattggcccagcaagcggttgccgacattgtcaccacctcagagatcgccattaaagca
cgcggcgcatttcatttagtgacagcaggcggtcgtacgcctaatcgtatttatcaactc
ctagcgcaaacggagcaggactggtcacgctggcatatttatacgggtgatgagcgtgtg
gcaccgcttggcgatacccagcgaaatgcaaccgctttgtttagccattggcttaatgag
gtgtcgataccggaagctaacctgcacctgatgcagacccattggccggttgctgaggca
ctggctgattatcagcaacaggttgccggtcttgtgtttgatatgaccttgcttggtatg
ggggaggacggccatactgccagtttgtttcccaaccaggcctggcgcattctggcaggc
gatgtggcgctagttattgattccccaaagcctccgccggtacgtttaactctaacctta
gcctgtttaaatcgctctaggcaaataattaaactgattaccggtgctgaaaagaatcct
gcgattttggagtggttggctggcgatgagttacccatagtagccccgcttggtagcgag
gtcacaaaggtctatttggatgagtcagcttgtttgggtgcttga

DBGET integrated database retrieval system