KEGG   Thioalkalimicrobium cyclicum: Thicy_0755Help
Entry
Thicy_0755        CDS       T01517                                 

Definition
6-phosphogluconolactonase (EC:3.1.1.31)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thicy_0755
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thicy_0755
Enzymes [BR:tcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Thicy_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
905506..906210
Genome map
AA seq 234 aa AA seqDB search
MTSPAEVVYPKEWRIFKNSELLAQQAVADIVTTSEIAIKARGAFHLVTAGGRTPNRIYQL
LAQTEQDWSRWHIYTGDERVAPLGDTQRNATALFSHWLNEVSIPEANLHLMQTHWPVAEA
LADYQQQVAGLVFDMTLLGMGEDGHTASLFPNQAWRILAGDVALVIDSPKPPPVRLTLTL
ACLNRSRQIIKLITGAEKNPAILEWLAGDELPIVAPLGSEVTKVYLDESACLGA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcccgctgaggttgtttaccccaaagaatggcgtatttttaaaaacagcgag
ttattggcccagcaagcggttgccgacattgtcaccacctcagagatcgccattaaagca
cgcggcgcatttcatttagtgacagcaggcggtcgtacgcctaatcgtatttatcaactc
ctagcgcaaacggagcaggactggtcacgctggcatatttatacgggtgatgagcgtgtg
gcaccgcttggcgatacccagcgaaatgcaaccgctttgtttagccattggcttaatgag
gtgtcgataccggaagctaacctgcacctgatgcagacccattggccggttgctgaggca
ctggctgattatcagcaacaggttgccggtcttgtgtttgatatgaccttgcttggtatg
ggggaggacggccatactgccagtttgtttcccaaccaggcctggcgcattctggcaggc
gatgtggcgctagttattgattccccaaagcctccgccggtacgtttaactctaacctta
gcctgtttaaatcgctctaggcaaataattaaactgattaccggtgctgaaaagaatcct
gcgattttggagtggttggctggcgatgagttacccatagtagccccgcttggtagcgag
gtcacaaaggtctatttggatgagtcagcttgtttgggtgcttga

DBGET integrated database retrieval system